Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G36960 69 / 1e-14 MYB TKI1 TSL-kinase interacting protein 1 (.1.2.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10013816 [exp] 195 / 1e-59 AT2G36960 660 / 0.0 TSL-kinase interacting protein 1 (.1.2.3) Lus10026528 [exp] 183 / 1e-55 AT2G36960 526 / 4e-178 TSL-kinase interacting protein 1 (.1.2.3)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G091700 [exp] 112 / 8e-30 AT2G36960 665 / 0.0 TSL-kinase interacting protein 1 (.1.2.3) Potri.006G125400 [exp] 104 / 3e-27 AT2G36960 680 / 0.0 TSL-kinase interacting protein 1 (.1.2.3)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10010230 pacid=23174318 polypeptide=Lus10010230 locus=Lus10010230.g ID=Lus10010230.BGIv1.0 annot-version=v1.0 ATGCAAAATACTAAGGATAAGCTGAGACTAAGCAATGGTATTTGCATTATCTGCCTCACCAACATCAGTGTTAGAGATCTAGTTTCCGAAGTGACTCAAA ATGATCAATGTCTTGAGCCAGTCCCCTTCAGTTGTGATTCATTCGATGTCGTTATTGCTGCCCATATATCAAAACATCAAAACAAGTTGGGATTTCCACC ATTAGGGCAACCACAGACATCATCTATCTGGGATGCAGATGAAACATGTGATGCCTTCTCATTTCAAGGGAATCATATTTCTCATCAACAAGTGTTGAGG ACATCCAATGTGACTTCATTAACAGCTGGGAAACAGGTTGATTGA
AA sequence Show only first row Show all	>Lus10010230 pacid=23174318 polypeptide=Lus10010230 locus=Lus10010230.g ID=Lus10010230.BGIv1.0 annot-version=v1.0 MQNTKDKLRLSNGICIICLTNISVRDLVSEVTQNDQCLEPVPFSCDSFDVVIAAHISKHQNKLGFPPLGQPQTSSIWDADETCDAFSFQGNHISHQQVLR TSNVTSLTAGKQVD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G36960	MYB	TKI1	TSL-kinase interacting protein...		Lus10010230 [exp]	0	1
AT1G68490			unknown protein		Lus10027557 [exp]	1.0	0.9489
AT4G24190		AtHsp90-7, HSP9...	SHEPHERD, HEAT SHOCK PROTEIN 9...		Lus10035109 [exp]	1.4	0.9358
AT1G22540			Major facilitator superfamily ...		Lus10001287 [exp]	2.2	0.8833
AT1G22620		ATSAC1	suppressor of actin 1, Phospho...		Lus10016941 [exp]	2.4	0.9242
					Lus10014031 [exp]	5.3	0.8772
AT5G14930		GENE101, SAG101	senescence-associated gene 101...		Lus10004841 [exp]	6.6	0.9141
					Lus10011631 [exp]	6.9	0.8725
					Lus10012521 [exp]	8.7	0.7740
AT1G04480			Ribosomal protein L14p/L23e fa...		Lus10008065 [exp]	9.5	0.8505
AT1G47890		AtRLP7	receptor like protein 7 (.1)		Lus10004309 [exp]	9.7	0.8403

Compare expression of checked genes

Lus10010230 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.