Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G42860 72 / 3e-16 unknown protein AT1G45688 67 / 2e-14 unknown protein AT4G35170 67 / 2e-14 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT2G41990 50 / 2e-08 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10010232 [exp] 160 / 5e-50 AT1G45688 416 / 3e-146 unknown protein Lus10009749 [exp] 157 / 2e-49 AT5G42860 256 / 2e-84 unknown protein Lus10029743 [exp] 85 / 6e-21 AT1G45688 301 / 4e-101 unknown protein Lus10022644 [exp] 64 / 2e-13 AT4G35170 279 / 4e-93 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10023652 [exp] 56 / 2e-10 AT1G45688 183 / 2e-55 unknown protein Lus10034926 [exp] 55 / 5e-10 AT1G45688 182 / 5e-55 unknown protein Lus10025793 [exp] 48 / 1e-07 AT1G45688 221 / 5e-70 unknown protein Lus10035869 [exp] 48 / 1e-07 AT1G45688 219 / 3e-69 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G026800 [exp] 103 / 5e-28 AT1G45688 301 / 2e-101 unknown protein Potri.002G124600 [exp] 96 / 2e-25 AT1G45688 284 / 1e-94 unknown protein Potri.007G045000 [exp] 96 / 2e-25 AT1G45688 273 / 4e-90 unknown protein Potri.004G180900 [exp] 64 / 2e-13 AT2G41990 256 / 1e-84 unknown protein Potri.009G140600 [exp] 62 / 1e-12 AT2G41990 232 / 5e-75 unknown protein Potri.001G183600 [exp] 55 / 4e-10 AT1G45688 185 / 4e-56 unknown protein Potri.006G160100 [exp] 52 / 3e-09 AT3G24600 184 / 3e-54 Late embryogenesis abundant protein, group 2 (.1) Potri.003G052900 [exp] 52 / 5e-09 AT1G45688 176 / 6e-53 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10010231 pacid=23174314 polypeptide=Lus10010231 locus=Lus10010231.g ID=Lus10010231.BGIv1.0 annot-version=v1.0 ATGTTTTGTGAGAAGAGAAGTAGCCAGAGATCGGTGGCGATATCGATCGGCGGGGATAAGATCCCGATGTACGGAAGCGGAGCAGGACTGAGCAGTACGG CAACTGGAAGGCCGTTGCTTCCGATTCATCTGACGCTCAATTTCACAGTGAAATCAAGAGCCTACGTTCTTGGGAAATTGGTGAAGCCGAGATTCTACAA GACGATTGGATGCGACATTACTTTCGACCCAAAGAAGCTTAACGCCACAATCTCGCTCAAGAACGCCTGCACATACGACTGA
AA sequence Show only first row Show all	>Lus10010231 pacid=23174314 polypeptide=Lus10010231 locus=Lus10010231.g ID=Lus10010231.BGIv1.0 annot-version=v1.0 MFCEKRSSQRSVAISIGGDKIPMYGSGAGLSSTATGRPLLPIHLTLNFTVKSRAYVLGKLVKPRFYKTIGCDITFDPKKLNATISLKNACTYD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G42860			unknown protein		Lus10010231 [exp]	0	1
AT5G01710			methyltransferases (.1)		Lus10001267 [exp]	1.0	0.8947
AT3G28180		ATCSLC4, CSLC4,...	CELLULOSE-SYNTHASE LIKE C4, Ce...		Lus10039475 [exp]	2.4	0.8783
AT1G45688			unknown protein		Lus10010232 [exp]	4.6	0.8621
AT1G26610	C2H2ZnF		C2H2-like zinc finger protein ...		Lus10004659 [exp]	6.9	0.7712
AT2G24290			Protein of unknown function (D...		Lus10036299 [exp]	11.0	0.7791
AT5G26667		PYR6	P-loop containing nucleoside t...		Lus10033733 [exp]	14.3	0.8035
AT5G66920		SKS17	SKU5 similar 17 (.1)		Lus10022465 [exp]	14.7	0.7959
AT5G01710			methyltransferases (.1)		Lus10012217 [exp]	18.1	0.8161
AT1G05170			Galactosyltransferase family p...		Lus10040062 [exp]	19.3	0.7380
AT3G19680			Protein of unknown function (D...		Lus10020509 [exp]	20.6	0.7976

Compare expression of checked genes

Lus10010231 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.