Lus10010240 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G53160 153 / 2e-44 UGT73C7 UDP-glucosyl transferase 73C7 (.1)
AT4G34135 150 / 3e-43 UGT73B2 UDP-glucosyltransferase 73B2 (.1.2)
AT4G34131 149 / 8e-43 UGT73B3 UDP-glucosyl transferase 73B3 (.1)
AT4G34138 145 / 1e-41 UGT73B1 UDP-glucosyl transferase 73B1 (.1)
AT2G15480 145 / 2e-41 UGT73B5 UDP-glucosyl transferase 73B5 (.1.2)
AT2G15490 141 / 6e-40 UGT73B4 UDP-glycosyltransferase 73B4 (.1.2.3)
AT3G53150 140 / 2e-39 UGT73D1 UDP-glucosyl transferase 73D1 (.1)
AT2G36800 138 / 8e-39 UGT73C5, DOGT1 UDP-GLUCOSYL TRANSFERASE 73C5, don-glucosyltransferase 1 (.1)
AT2G36780 138 / 9e-39 UDP-Glycosyltransferase superfamily protein (.1)
AT2G36770 134 / 4e-37 UDP-Glycosyltransferase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10010239 305 / 1e-102 AT2G15480 392 / 3e-132 UDP-glucosyl transferase 73B5 (.1.2)
Lus10014080 166 / 1e-50 AT2G15480 330 / 3e-110 UDP-glucosyl transferase 73B5 (.1.2)
Lus10019835 163 / 7e-48 AT2G15480 476 / 3e-165 UDP-glucosyl transferase 73B5 (.1.2)
Lus10019831 155 / 2e-45 AT2G15490 425 / 8e-146 UDP-glycosyltransferase 73B4 (.1.2.3)
Lus10014083 155 / 6e-45 AT4G34131 489 / 2e-170 UDP-glucosyl transferase 73B3 (.1)
Lus10014084 154 / 7e-45 AT2G15490 445 / 2e-153 UDP-glycosyltransferase 73B4 (.1.2.3)
Lus10019833 153 / 2e-44 AT2G15480 483 / 2e-168 UDP-glucosyl transferase 73B5 (.1.2)
Lus10019832 152 / 4e-44 AT2G15490 494 / 1e-172 UDP-glycosyltransferase 73B4 (.1.2.3)
Lus10014082 149 / 6e-43 AT2G15480 483 / 3e-168 UDP-glucosyl transferase 73B5 (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G123700 184 / 3e-56 AT4G34131 446 / 3e-153 UDP-glucosyl transferase 73B3 (.1)
Potri.001G303000 162 / 9e-48 AT4G34131 573 / 0.0 UDP-glucosyl transferase 73B3 (.1)
Potri.001G303600 159 / 1e-46 AT4G34131 568 / 0.0 UDP-glucosyl transferase 73B3 (.1)
Potri.009G098966 157 / 6e-46 AT4G34131 588 / 0.0 UDP-glucosyl transferase 73B3 (.1)
Potri.016G097400 157 / 1e-45 AT3G53150 626 / 0.0 UDP-glucosyl transferase 73D1 (.1)
Potri.001G303300 155 / 4e-45 AT2G15480 555 / 0.0 UDP-glucosyl transferase 73B5 (.1.2)
Potri.001G303700 154 / 1e-44 AT2G15480 558 / 0.0 UDP-glucosyl transferase 73B5 (.1.2)
Potri.009G099032 152 / 4e-44 AT2G15490 558 / 0.0 UDP-glycosyltransferase 73B4 (.1.2.3)
Potri.006G120600 152 / 7e-44 AT3G53150 617 / 0.0 UDP-glucosyl transferase 73D1 (.1)
Potri.001G302400 149 / 8e-43 AT2G15490 494 / 1e-172 UDP-glycosyltransferase 73B4 (.1.2.3)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0113 GT-B PF00201 UDPGT UDP-glucoronosyl and UDP-glucosyl transferase
Representative CDS sequence
>Lus10010240 pacid=23174315 polypeptide=Lus10010240 locus=Lus10010240.g ID=Lus10010240.BGIv1.0 annot-version=v1.0
ATGGGGTTATTTAATTCAAAAGTTAGGGCGTCGTATAAAGTAGTAAGTAATTCAAGGAGCTATCAAAGAGCTTGGCAATTGGGACCTGTTTCTCTCTTCG
TCAATCGGATTAATCTCGACGTCAGCAAGTTCACCAGCGGCGGTAAAGCGGCGGCGGATGTCATCACCGGAGATAAATTTTTGAATTGGCTCGATTCCGA
GAAACCCAACTCTGTCCTCTATTTTTGCTTGGGAAGTCTCACAAGGTTCACCAAAACACAAATCTCTGAAATAGCTACCGCCTTGGAGGAATCAAATCAT
CCTTTCATATGGGTAGTTGCCAAAATCCTTAAAGGGGATGTCGATGAGGACAAGGAAGAAAAAGAAGAATGGTGGTTACCTCAAGGATTTGAGGAGAGGG
TGGTCGGGAAAGGGATGATTATAAAAGGGTGGGTCCCTCAGACGATGATTTTGGAACACGCTTCGATCAGGGGGTTTGTGACGCATTGTGGATGGAATTT
GATTATGGAAGGTGTCTGCGGAGGCGTTTCGATGGTGACATGGCCAATTTTTGCGGAATAA
AA sequence
>Lus10010240 pacid=23174315 polypeptide=Lus10010240 locus=Lus10010240.g ID=Lus10010240.BGIv1.0 annot-version=v1.0
MGLFNSKVRASYKVVSNSRSYQRAWQLGPVSLFVNRINLDVSKFTSGGKAAADVITGDKFLNWLDSEKPNSVLYFCLGSLTRFTKTQISEIATALEESNH
PFIWVVAKILKGDVDEDKEEKEEWWLPQGFEERVVGKGMIIKGWVPQTMILEHASIRGFVTHCGWNLIMEGVCGGVSMVTWPIFAE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G34135 UGT73B2 UDP-glucosyltransferase 73B2 (... Lus10010240 0 1
AT2G25010 Aminotransferase-like, plant m... Lus10003764 1.4 0.8303
AT5G40250 RING/U-box superfamily protein... Lus10008797 2.0 0.8303
AT1G52790 2-oxoglutarate (2OG) and Fe(II... Lus10005776 5.0 0.7172
AT1G20590 Cyclin family protein (.1) Lus10036416 10.4 0.6711
AT1G65440 GTB1 global transcription factor gr... Lus10034231 12.8 0.6788
AT1G49320 ATUSPL1 unknown seed protein like 1 (.... Lus10032324 13.4 0.7333
Lus10012676 15.1 0.7274
Lus10007991 19.9 0.6957
AT4G17810 C2H2ZnF ZFP12 C2H2 and C2HC zinc fingers sup... Lus10004578 20.7 0.6932
AT1G70890 MLP43 MLP-like protein 43 (.1) Lus10012467 21.9 0.7112

Lus10010240 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.