Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10034727 [exp] 40 / 0.0001 AT5G61340 193 / 4e-59 unknown protein Lus10021641 [exp] 38 / 0.0006 AT5G61340 191 / 5e-58 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G060900 [exp] 38 / 0.0006 AT5G61340 164 / 5e-48 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10010246 pacid=23169948 polypeptide=Lus10010246 locus=Lus10010246.g ID=Lus10010246.BGIv1.0 annot-version=v1.0 ATGGCTGCCTCGCTGGTTCGCTGTTCGATCAGCCGGTGGGTCTGCGCTGCCACTGCCGCCGCCAGCGCTTCCAAGAAGAAGGGCTCTACCGGGCTCACTG GATCTACTTATGGTGGCTCTTTCCGTCAAGTGGAAGCCGACATCCGTCCTCCACAAGGTCGAGCCAATGTCGAATTAGGGAGCAGCTCGTCCACCGGCGG AGGCGGGGACGTCGGTTTCGATGAGAGGGTTGAGAAGAAGCAGATGATTTGTTGGAGAGCTTCGACGGCTCTATATCTGGCTCTTCACGTTAACGTAGCG ACAGCCGGAATTGAAGCTCTGTTTTAG
AA sequence Show only first row Show all	>Lus10010246 pacid=23169948 polypeptide=Lus10010246 locus=Lus10010246.g ID=Lus10010246.BGIv1.0 annot-version=v1.0 MAASLVRCSISRWVCAATAAASASKKKGSTGLTGSTYGGSFRQVEADIRPPQGRANVELGSSSSTGGGGDVGFDERVEKKQMICWRASTALYLALHVNVA TAGIEALF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10010246 [exp]	0	1
AT3G09290	C2H2ZnF	TAC1	telomerase activator1 (.1)		Lus10022204 [exp]	5.1	0.7846
AT3G47570			Leucine-rich repeat protein ki...		Lus10003072 [exp]	17.4	0.8155
					Lus10024542 [exp]	20.9	0.7464
AT5G67640			unknown protein		Lus10011552 [exp]	24.0	0.8335
AT3G22600			Bifunctional inhibitor/lipid-t...		Lus10010573 [exp]	25.7	0.8334
AT3G18990	B3	REM39, VRN1	REDUCED VERNALIZATION RESPONSE...		Lus10002934 [exp]	29.1	0.7670
AT5G10530			Concanavalin A-like lectin pro...		Lus10029555 [exp]	30.0	0.8254
AT3G22600			Bifunctional inhibitor/lipid-t...		Lus10039349 [exp]	35.4	0.8283
AT3G04720		HEL, PR-4, PR4	HEVEIN-LIKE, pathogenesis-rela...		Lus10003262 [exp]	40.4	0.7706
AT3G55960			Haloacid dehalogenase-like hyd...		Lus10040202 [exp]	41.0	0.7397

Compare expression of checked genes

Lus10010246 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.