Lus10010248 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10012084 56 / 9e-11 ND /
Lus10010259 52 / 1e-08 ND /
Lus10005115 47 / 8e-08 ND /
Lus10020965 47 / 4e-07 ND /
Lus10001094 42 / 9e-06 ND /
Lus10019357 40 / 0.0002 ND /
Lus10010258 37 / 0.0005 ND /
Lus10034328 38 / 0.0008 ND /
Lus10019565 0 / 1 ND /
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10010248 pacid=23169943 polypeptide=Lus10010248 locus=Lus10010248.g ID=Lus10010248.BGIv1.0 annot-version=v1.0
ATGGGTGGTGATGCTAGTGGCGAGGGCGGTGATGAAAATTGCCACCCTAAGAAGGTGAAGAAAGAACGGTATAACTACATATGGTCGAGTTTTGTGAAAG
GGTTGGCGAATGAACCTAACACTGATACCAATATAGCAAGAATGATGTTGTTGGGAAAGCATATAATGCAAGGGATAGGCAAGAGAAATCAGGAAGAGTG
TGTTATGGTGGGTTTGGAGTTCAAGCAAAATGGTTGGCTTGACCCCGAATTGGAGGAGATGAGGCGTATGCTCGAAAGTCAAGGATGTGGTGGTACCACA
ATGCCACCGGATACCAACACTCTAACGAACGTGCATGAAGAGAGAGACGATGAAGATGATGACAATGATGAAGAGCAGTGTTTCAAATTAGGATTATGA
AA sequence
>Lus10010248 pacid=23169943 polypeptide=Lus10010248 locus=Lus10010248.g ID=Lus10010248.BGIv1.0 annot-version=v1.0
MGGDASGEGGDENCHPKKVKKERYNYIWSSFVKGLANEPNTDTNIARMMLLGKHIMQGIGKRNQEECVMVGLEFKQNGWLDPELEEMRRMLESQGCGGTT
MPPDTNTLTNVHEERDDEDDDNDEEQCFKLGL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10010248 0 1
AT5G12390 FIS1B FISSION 1B, Tetratricopeptide ... Lus10009707 1.0 0.8648
AT4G08180 ORP1C OSBP(oxysterol binding protein... Lus10025695 2.4 0.8214
AT2G15220 Plant basic secretory protein ... Lus10014107 4.0 0.7588
AT1G06640 2-oxoglutarate (2OG) and Fe(II... Lus10013314 5.5 0.7585
AT2G48020 Major facilitator superfamily ... Lus10042676 7.0 0.7240
AT2G30130 AS2 PCK1, LBD12, AS... PEACOCK 1, Lateral organ bound... Lus10005284 14.7 0.6862
AT3G17152 Plant invertase/pectin methyle... Lus10017077 23.5 0.6573
AT2G27035 AtENODL20 early nodulin-like protein 20 ... Lus10026749 24.2 0.6815
AT4G21020 Late embryogenesis abundant pr... Lus10015427 26.2 0.6341
AT2G19330 PIRL6 plant intracellular ras group-... Lus10003229 26.7 0.7670

Lus10010248 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.