Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G47390 35 / 0.001 MYB myb-like transcription factor family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10038279 [exp] 110 / 1e-30 AT3G16350 279 / 5e-91 Homeodomain-like superfamily protein (.1) Lus10025822 [exp] 107 / 1e-29 AT3G16350 283 / 2e-92 Homeodomain-like superfamily protein (.1) Lus10006826 [exp] 61 / 1e-12 AT3G16350 235 / 1e-74 Homeodomain-like superfamily protein (.1) Lus10037560 [exp] 60 / 3e-12 AT3G16350 303 / 8e-101 Homeodomain-like superfamily protein (.1) Lus10004384 [exp] 39 / 5e-05 AT5G47390 394 / 3e-137 myb-like transcription factor family protein (.1) Lus10040181 [exp] 37 / 0.0003 AT5G47390 398 / 1e-138 myb-like transcription factor family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G189800 [exp] 59 / 3e-12 AT3G16350 307 / 2e-102 Homeodomain-like superfamily protein (.1) Potri.003G049100 [exp] 56 / 8e-11 AT3G16350 311 / 8e-104 Homeodomain-like superfamily protein (.1) Potri.003G079500 [exp] 43 / 2e-06 AT5G47390 355 / 4e-122 myb-like transcription factor family protein (.1) Potri.001G155300 [exp] 39 / 4e-05 AT5G47390 340 / 7e-116 myb-like transcription factor family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10010253 pacid=23169952 polypeptide=Lus10010253 locus=Lus10010253.g ID=Lus10010253.BGIv1.0 annot-version=v1.0 ATGGTTCCCAAAGAACCGGTCAACGTAGAAGAACTCGTGGGCATCTCTCACTTGAGCCTTGGAGATTGTGCCGGTCTAAAATTGACATCTGAAGCATCAA GGCAGACGGCGTTTCATGCTAATGCACATGGAAGTGGATTTGATATGGTAGTAGGGAAGGGGAAGAAGGGCAGCAATAACTCCATTGAAGTAGTATGA
AA sequence Show only first row Show all	>Lus10010253 pacid=23169952 polypeptide=Lus10010253 locus=Lus10010253.g ID=Lus10010253.BGIv1.0 annot-version=v1.0 MVPKEPVNVEELVGISHLSLGDCAGLKLTSEASRQTAFHANAHGSGFDMVVGKGKKGSNNSIEVV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10010253 [exp]	0	1
					Lus10027774 [exp]	1.0	0.9910
AT2G18180			Sec14p-like phosphatidylinosit...		Lus10028332 [exp]	1.4	0.9833
AT5G67360		ARA12	Subtilase family protein (.1)		Lus10002244 [exp]	2.8	0.8827
AT1G14930			Polyketide cyclase/dehydrase a...		Lus10042490 [exp]	3.7	0.9025
AT3G09730			unknown protein		Lus10023175 [exp]	4.6	0.8372
AT4G28320		MAN5, AtMAN5	endo-beta-mannase 5, Glycosyl ...		Lus10039719 [exp]	4.9	0.9103
AT3G20820			Leucine-rich repeat (LRR) fami...		Lus10033932 [exp]	8.9	0.8731
AT1G79690		ATNUDT3	nudix hydrolase homolog 3 (.1)		Lus10024090 [exp]	9.5	0.9185
AT3G61220		SDR1	short-chain dehydrogenase/redu...		Lus10014690 [exp]	9.5	0.9093
AT3G16210			F-box family protein (.1)		Lus10031512 [exp]	16.0	0.7843

Compare expression of checked genes

Lus10010253 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.