Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G37290 54 / 7e-11 unknown protein AT1G49800 44 / 5e-07 unknown protein AT2G23270 43 / 1e-06 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019310 [exp] 98 / 6e-28 AT4G37290 56 / 1e-11 unknown protein Lus10011512 [exp] 92 / 1e-25 AT4G37290 57 / 3e-12 unknown protein Lus10010257 [exp] 56 / 2e-11 ND 37 / 3e-04
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G015600 [exp] 103 / 2e-30 AT4G37290 45 / 2e-07 unknown protein Potri.007G049500 [exp] 102 / 1e-29 AT4G37290 48 / 1e-08 unknown protein Potri.005G142900 [exp] 99 / 2e-28 AT4G37290 44 / 4e-07 unknown protein Potri.006G008066 [exp] 95 / 2e-25 AT2G23270 45 / 2e-06 unknown protein Potri.001G299800 [exp] 59 / 2e-12 AT1G49800 44 / 1e-06 unknown protein Potri.006G008132 [exp] 58 / 8e-12 ND / Potri.007G049400 [exp] 54 / 6e-11 AT4G37290 46 / 5e-08 unknown protein Potri.001G299900 [exp] 51 / 1e-09 AT1G49800 48 / 2e-08 unknown protein Potri.009G095600 [exp] 50 / 2e-09 AT1G49800 / unknown protein Potri.014G022200 [exp] 48 / 2e-08 ND /
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10010255 pacid=23169959 polypeptide=Lus10010255 locus=Lus10010255.g ID=Lus10010255.BGIv1.0 annot-version=v1.0 ATGGCAGCTTTTACCAAATCGGTTTGGTTCTTGGTTTTTGTGGCGATGGTGCTCTCTGTTCTGTTATCCAGTACCGCCGAAGCGGGTCGGCCGTTCCTGA AATCAGAGACGGCGGAGGAGACAGCTGGCAGAGCAATCGAACGATTCTTCGACGGGTTAGCACTGGGAGCGATCAAGGACTCAGGACCGAGCCCTGGAGT AGGCCACTCGTTCACCAACGCCGCTACACTGGGCGGAATTAAAGATTCTGGACCCAGTCCGGGAGTGGGTCACAGCTTTGTAACCGGAACCCACCAGTGA
AA sequence Show only first row Show all	>Lus10010255 pacid=23169959 polypeptide=Lus10010255 locus=Lus10010255.g ID=Lus10010255.BGIv1.0 annot-version=v1.0 MAAFTKSVWFLVFVAMVLSVLLSSTAEAGRPFLKSETAEETAGRAIERFFDGLALGAIKDSGPSPGVGHSFTNAATLGGIKDSGPSPGVGHSFVTGTHQ

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G37290			unknown protein		Lus10010255 [exp]	0	1
AT3G12500		PR-3, PR3, CHI-...	PATHOGENESIS-RELATED 3, basic ...		Lus10028377 [exp]	1.0	0.9982
AT3G26770			NAD(P)-binding Rossmann-fold s...		Lus10032192 [exp]	1.4	0.9979
AT4G37290			unknown protein		Lus10019310 [exp]	3.0	0.9969
AT5G37490			ARM repeat superfamily protein...		Lus10001079 [exp]	4.0	0.9968
AT4G36810		GGPS1	geranylgeranyl pyrophosphate s...		Lus10017624 [exp]	4.2	0.9954
AT4G31940		CYP82C4	"cytochrome P450, family 82, s...		Lus10022762 [exp]	4.5	0.9962
AT3G09520		ATEXO70H4	exocyst subunit exo70 family p...		Lus10024438 [exp]	6.3	0.9937
					Lus10010257 [exp]	6.6	0.9929
AT2G42360			RING/U-box superfamily protein...		Lus10002194 [exp]	7.5	0.9918
AT1G68340			Protein of unknown function (D...		Lus10027232 [exp]	7.7	0.9808

Compare expression of checked genes

Lus10010255 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.