Lus10010256 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10010256 pacid=23169937 polypeptide=Lus10010256 locus=Lus10010256.g ID=Lus10010256.BGIv1.0 annot-version=v1.0
ATGATTGCATCTTCATCTGCTGCTACCACTGCTACTTCTCCGCCGCTGCCACCGTGGTGTCTCCGACGAGAACCTATGTTGGTTGTCGGAACAAACATCG
ATGTCTTCCTCGTCATTGACCACGATGGTGGGAGGAATCGGATCCGGAATGGGATAAGAAACGCAGGCTTGCTATTCGCAGTTCGCAACGGTGGATGGGA
GTTAGTTGACGTTATATCCCGGAGGAAAGATCTCATCACTTCTGAAACCGGCCGGTTTCTGAAGGAGATGATAATTCAGGAAGATCGTTTTTTTAATCTA
AAGGAAGAAGAAAATCGACGTCTTCTGTTTGCTAGGTTATCGGTAAGCTTTTGA
AA sequence
>Lus10010256 pacid=23169937 polypeptide=Lus10010256 locus=Lus10010256.g ID=Lus10010256.BGIv1.0 annot-version=v1.0
MIASSSAATTATSPPLPPWCLRREPMLVVGTNIDVFLVIDHDGGRNRIRNGIRNAGLLFAVRNGGWELVDVISRRKDLITSETGRFLKEMIIQEDRFFNL
KEEENRRLLFARLSVSF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10010256 0 1
AT3G12910 NAC NAC (No Apical Meristem) domai... Lus10031189 14.8 0.7576
AT5G09360 LAC14 laccase 14 (.1) Lus10026812 18.2 0.7133
AT5G67240 SDN3 small RNA degrading nuclease 3... Lus10010220 50.6 0.6088
AT2G21610 PE11, ATPE11 A. THALIANA PECTINESTERASE 11,... Lus10042315 54.4 0.6557
AT3G04720 HEL, PR-4, PR4 HEVEIN-LIKE, pathogenesis-rela... Lus10006553 58.9 0.6746
AT4G27290 S-locus lectin protein kinase ... Lus10034815 80.0 0.6623
Lus10020479 80.5 0.6083
AT1G52540 Protein kinase superfamily pro... Lus10019988 102.4 0.5883
AT5G54160 ATOMT1 O-methyltransferase 1 (.1) Lus10030188 112.1 0.6533
AT3G57270 BG1 "beta-1,3-glucanase 1", beta-1... Lus10014109 163.8 0.6070

Lus10010256 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.