Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G22610 152 / 5e-44 C2 calcium/lipid-binding plant phosphoribosyltransferase family protein (.1) AT4G11610 124 / 2e-34 NTRB, ATNTRB C2 calcium/lipid-binding plant phosphoribosyltransferase family protein (.1) AT3G61300 123 / 7e-34 C2 calcium/lipid-binding plant phosphoribosyltransferase family protein (.1) AT3G57880 121 / 2e-33 Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase family protein (.1) AT1G51570 119 / 2e-32 Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase family protein (.1) AT5G12970 116 / 2e-31 Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase family protein (.1) AT4G00700 112 / 3e-30 C2 calcium/lipid-binding plant phosphoribosyltransferase family protein (.1) AT5G06850 112 / 3e-30 C2 calcium/lipid-binding plant phosphoribosyltransferase family protein (.1) AT5G48060 102 / 1e-26 C2 calcium/lipid-binding plant phosphoribosyltransferase family protein (.1) AT1G04150 84 / 3e-20 C2 calcium/lipid-binding plant phosphoribosyltransferase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009460 [exp] 175 / 7e-53 AT1G22610 627 / 0.0 C2 calcium/lipid-binding plant phosphoribosyltransferase family protein (.1) Lus10001538 [exp] 176 / 2e-52 AT1G22610 1425 / 0.0 C2 calcium/lipid-binding plant phosphoribosyltransferase family protein (.1) Lus10031816 [exp] 130 / 4e-37 AT4G11610 513 / 1e-176 C2 calcium/lipid-binding plant phosphoribosyltransferase family protein (.1) Lus10000605 [exp] 131 / 9e-37 AT4G11610 1634 / 0.0 C2 calcium/lipid-binding plant phosphoribosyltransferase family protein (.1) Lus10031244 [exp] 130 / 2e-36 AT5G12970 979 / 0.0 Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase family protein (.1) Lus10012026 [exp] 125 / 1e-34 AT3G57880 1496 / 0.0 Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase family protein (.1) Lus10016280 [exp] 124 / 3e-34 AT3G57880 1499 / 0.0 Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase family protein (.1) Lus10021030 [exp] 117 / 8e-32 AT5G06850 1383 / 0.0 C2 calcium/lipid-binding plant phosphoribosyltransferase family protein (.1) Lus10023823 [exp] 117 / 8e-32 AT5G06850 1382 / 0.0 C2 calcium/lipid-binding plant phosphoribosyltransferase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G107700 [exp] 150 / 2e-43 AT1G22610 1414 / 0.0 C2 calcium/lipid-binding plant phosphoribosyltransferase family protein (.1) Potri.019G080000 [exp] 141 / 3e-40 AT1G22610 1442 / 0.0 C2 calcium/lipid-binding plant phosphoribosyltransferase family protein (.1) Potri.001G105400 [exp] 136 / 2e-38 AT4G11610 1567 / 0.0 C2 calcium/lipid-binding plant phosphoribosyltransferase family protein (.1) Potri.003G125900 [exp] 133 / 1e-37 AT4G11610 1543 / 0.0 C2 calcium/lipid-binding plant phosphoribosyltransferase family protein (.1) Potri.002G158000 [exp] 132 / 2e-37 AT4G11610 1400 / 0.0 C2 calcium/lipid-binding plant phosphoribosyltransferase family protein (.1) Potri.014G081700 [exp] 129 / 3e-36 AT4G11610 1422 / 0.0 C2 calcium/lipid-binding plant phosphoribosyltransferase family protein (.1) Potri.006G058900 [exp] 128 / 7e-36 AT3G57880 1372 / 0.0 Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase family protein (.1) Potri.016G049100 [exp] 125 / 8e-35 AT3G57880 1425 / 0.0 Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase family protein (.1) Potri.T085601 [exp] 125 / 1e-34 AT5G12970 1315 / 0.0 Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase family protein (.1) Potri.003G210801 [exp] 125 / 1e-34 AT5G12970 1300 / 0.0 Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0154 [flax] [poplar] C2 PF00168 [flax] [poplar] C2 C2 domain
Representative CDS sequence Show only first row Show all	>Lus10010269 pacid=23169940 polypeptide=Lus10010269 locus=Lus10010269.g ID=Lus10010269.BGIv1.0 annot-version=v1.0 ATGAGGTACAACAAAGGAGGAGACAAGATGTCGAGCACTTACGATCTCGTCGAAAAGATGCATTTCTTATATGTAAGTGTTGTAAAAGCTAGAGATCTTC CTATAATGGATGTCCCCGGGAGTTTAGATCCTTATGTAGAAGTGAAGTTAGAGAACTACAAGGGGAAGACAAAGCACCACGAGAAGAATCAAAATCCGAC ATGGCATCAGATTTTCGCCTTTTCGATGGAGAGGTTACAATCGAATTTGTTTGAAGTTGTTGTGAAAGATAAGGATTGCTGCTATTCTGCTGTTGGGGTT GGTGGTGCCCTACTGATCTTTTAG
AA sequence Show only first row Show all	>Lus10010269 pacid=23169940 polypeptide=Lus10010269 locus=Lus10010269.g ID=Lus10010269.BGIv1.0 annot-version=v1.0 MRYNKGGDKMSSTYDLVEKMHFLYVSVVKARDLPIMDVPGSLDPYVEVKLENYKGKTKHHEKNQNPTWHQIFAFSMERLQSNLFEVVVKDKDCCYSAVGV GGALLIF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G22610			C2 calcium/lipid-binding plant...		Lus10010269 [exp]	0	1
					Lus10012521 [exp]	4.9	0.7104
AT3G44670			Disease resistance protein (TI...		Lus10008525 [exp]	12.2	0.7290
AT1G68490			unknown protein		Lus10027557 [exp]	23.5	0.7112
AT4G11170			Disease resistance protein (TI...		Lus10010222 [exp]	24.4	0.7224
AT3G05340			Tetratricopeptide repeat (TPR)...		Lus10015182 [exp]	30.4	0.5978
AT2G36960	MYB	TKI1	TSL-kinase interacting protein...		Lus10010230 [exp]	30.7	0.6929
AT5G56740		HAG02, HAC7, HA...	histone acetyltransferase of t...		Lus10032700 [exp]	38.9	0.6204
AT2G17040	NAC	ANAC036	NAC domain containing protein ...		Lus10023966 [exp]	43.4	0.6704
AT5G39960			GTP binding;GTP binding (.1)		Lus10033794 [exp]	45.6	0.6665
AT3G06030		AtANP3, MAPKKK1...	NPK1-related protein kinase 3 ...		Lus10031963 [exp]	46.3	0.5727

Compare expression of checked genes

Lus10010269 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.