Lus10010270 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10001305 162 / 9e-53 ND /
Lus10008832 153 / 9e-49 ND /
Lus10010399 150 / 8e-48 ND /
Lus10032877 147 / 2e-46 ND /
Lus10002726 149 / 1e-45 ND 37 / 0.008
Lus10003596 140 / 5e-43 ND /
Lus10014486 142 / 4e-42 ND /
Lus10034508 136 / 5e-42 ND /
Lus10040059 127 / 2e-37 ND /
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10010270 pacid=23169949 polypeptide=Lus10010270 locus=Lus10010270.g ID=Lus10010270.BGIv1.0 annot-version=v1.0
ATGGAGAGGGCACAAGGTGGTCCAGTAGGCAAGGGAGATCTATTTCTCGCCACTCACATGAAGGCTAATGGGAAGTCCTATCCCATGACTACAACAGAAA
AGAAAAGTAAGAAACTTAAGAGAAGTGGTGGTGCTTCTTTTTCCGCTCCTGTTGATCCAATACTCAATCCAACATTCTTCAAGCCGTTCACATCAGAAAT
GTTGAAGTTTTTATCCCGGGATGGAGTTGAACTTCGTCCGGTGCTAAAGGAGATGAGTAAAGCTTTCAAAACTCTCAATGCTAATAGAACTAGTTCTGAC
ATTAGTGTTAGAAATCCTACTAGTATGGGACAAAAGAAGAGTGTTGGAAAGAAGCGATTGGACAAGGATTTGCACATACCATATCATAGAGAAGAAGAGG
AAGAAGAAGAAGCAGCGGATCACAAGAATGCTTTGGAGTAG
AA sequence
>Lus10010270 pacid=23169949 polypeptide=Lus10010270 locus=Lus10010270.g ID=Lus10010270.BGIv1.0 annot-version=v1.0
MERAQGGPVGKGDLFLATHMKANGKSYPMTTTEKKSKKLKRSGGASFSAPVDPILNPTFFKPFTSEMLKFLSRDGVELRPVLKEMSKAFKTLNANRTSSD
ISVRNPTSMGQKKSVGKKRLDKDLHIPYHREEEEEEEAADHKNALE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10010270 0 1
AT3G51680 AtSDR2 short-chain dehydrogenase/redu... Lus10014227 1.0 0.9806
AT2G44450 BGLU15 beta glucosidase 15 (.1) Lus10031235 1.7 0.9745
AT3G05670 RING/U-box protein (.1) Lus10007973 2.0 0.9754
AT2G33420 Protein of unknown function (D... Lus10011785 2.8 0.9649
AT3G12500 PR-3, PR3, CHI-... PATHOGENESIS-RELATED 3, basic ... Lus10041831 3.7 0.9560
AT3G28960 Transmembrane amino acid trans... Lus10023029 4.2 0.9321
AT4G36220 CYP84A1, FAH1, ... ferulic acid 5-hydroxylase 1 (... Lus10000326 4.5 0.9388
AT4G05230 Ubiquitin-like superfamily pro... Lus10007641 5.7 0.9383
AT3G61510 AT-ACS1, ACS1 ARABIDOPSIS THALIANA 1-AMINOCY... Lus10007910 6.3 0.9644
AT5G45020 Glutathione S-transferase fami... Lus10026012 6.9 0.9576

Lus10010270 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.