Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10017734 [exp] 146 / 1e-46 ND / Lus10006589 [exp] 142 / 3e-42 AT3G18970 140 / 2e-37 mitochondrial editing factor 20 (.1) Lus10014486 [exp] 133 / 6e-39 ND / Lus10039365 [exp] 107 / 7e-32 ND / Lus10013669 [exp] 98 / 1e-27 ND / Lus10014482 [exp] 90 / 8e-25 ND 38 / 3e-04 Lus10040059 [exp] 89 / 6e-23 ND / Lus10012424 [exp] 59 / 8e-13 ND / Lus10021782 [exp] 51 / 2e-09 ND /
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10010271 pacid=23169953 polypeptide=Lus10010271 locus=Lus10010271.g ID=Lus10010271.BGIv1.0 annot-version=v1.0 ATGGATGGAGGTCCCAGCTTGGGTGGTGCAAGTGGAGCTGGTGATGGAGGTGATGATGAACGTCGTCCCAAGAAGGAACAAAGGCAATGGTGGTATGTAC ACCTAGTTGATGCGAATGATGAAGATTTAGGGATCGAGGCTTGGAAGACAAAAGATTGGGCAAAGTTAGGGCGTAATGGAAAGAAGATAATGATACACAT TGACTCATTTGGGCTTCCACCTGGGGAGGGTGGCGGATACTTGCGCCAGTTCCTTGGGAAGTGTGCAAAACATGAAGGTTACCTACCACTCAGGGTCGAG GATTGGCATGTCATAGATTTAGAGAGCAAGGGAGCACTTTTGGGATGA
AA sequence Show only first row Show all	>Lus10010271 pacid=23169953 polypeptide=Lus10010271 locus=Lus10010271.g ID=Lus10010271.BGIv1.0 annot-version=v1.0 MDGGPSLGGASGAGDGGDDERRPKKEQRQWWYVHLVDANDEDLGIEAWKTKDWAKLGRNGKKIMIHIDSFGLPPGEGGGYLRQFLGKCAKHEGYLPLRVE DWHVIDLESKGALLG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10010271 [exp]	0	1
					Lus10012132 [exp]	1.4	0.9526
AT1G22400		ATUGT85A1, UGT8...	ARABIDOPSIS THALIANA UDP-GLUCO...		Lus10027514 [exp]	1.7	0.9389
AT3G07840			Pectin lyase-like superfamily ...		Lus10011030 [exp]	2.0	0.9488
AT1G14185			Glucose-methanol-choline (GMC)...		Lus10030463 [exp]	2.4	0.8992
AT2G37890			Mitochondrial substrate carrie...		Lus10036193 [exp]	3.2	0.8841
AT3G28960			Transmembrane amino acid trans...		Lus10023029 [exp]	3.5	0.9276
AT5G01250			alpha 1,4-glycosyltransferase ...		Lus10035526 [exp]	4.1	0.8585
					Lus10000890 [exp]	5.7	0.8647
					Lus10041755 [exp]	7.5	0.7985
AT5G13220	ZIM	JAS1, TIFY9, JA...	TIFY DOMAIN PROTEIN 9, JASMONA...		Lus10002576 [exp]	9.5	0.8335

Compare expression of checked genes

Lus10010271 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.