Lus10010283 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G02880 295 / 3e-102 TPK1 thiamin pyrophosphokinase1 (.1.2.3.4)
AT2G44750 284 / 1e-97 TPK2 thiamin pyrophosphokinase 2 (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10036348 313 / 1e-109 AT1G02880 327 / 1e-113 thiamin pyrophosphokinase1 (.1.2.3.4)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G205800 325 / 2e-113 AT1G02880 385 / 4e-136 thiamin pyrophosphokinase1 (.1.2.3.4)
Potri.014G130900 322 / 1e-112 AT1G02880 395 / 8e-141 thiamin pyrophosphokinase1 (.1.2.3.4)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04263 TPK_catalytic Thiamin pyrophosphokinase, catalytic domain
PF04265 TPK_B1_binding Thiamin pyrophosphokinase, vitamin B1 binding domain
Representative CDS sequence
>Lus10010283 pacid=23169526 polypeptide=Lus10010283 locus=Lus10010283.g ID=Lus10010283.BGIv1.0 annot-version=v1.0
ATGCCTCTTCTCTTCCCTCACGAATCTGCCGCCGATGTTCGCCACAGGTTCAGGCCAGACGTAATCAAAGGGGATATGGATTCGGTTCGATCCGAAGTTC
TTAACTTCTACAGTGATCTGGGAATCAAGGTAGTTGATGAATCTCATGATCAAGATACCACTGATCTGCACAAGTGTGTGGCTTATATAAGAAATGTGAT
ACCAGATGTCGACAAGTCTAGCCTTTGCATCCTTGTAACTGGATCGCTTGGAGGTCGTTTTGATCATGAAGCTGGCAACATCAATGTCATACACCGCTTC
TCAACCACGAGGATAATCCTTCTATCAGACGAATGCCTCATTTATCTACTCCCAAAGACTCACTACCATGAAATACACGTGAACTCCTCGTTCGAGGGGC
CGCATTGTGGTCTCATCCCAATAGGAAAGCCATCGATGAGAACTACAACAACCGGTCTTCAATGGGACCTCAATGATACGGAGATGATGTTTGGTGGACT
AGTAAGTACGTCGAACAAAGTTAGAGCAGAAAAGGTTACGGTGGAATCGGACGAAGATCTGTTGTGGACCATATCAATAAAAAAGGATTGA
AA sequence
>Lus10010283 pacid=23169526 polypeptide=Lus10010283 locus=Lus10010283.g ID=Lus10010283.BGIv1.0 annot-version=v1.0
MPLLFPHESAADVRHRFRPDVIKGDMDSVRSEVLNFYSDLGIKVVDESHDQDTTDLHKCVAYIRNVIPDVDKSSLCILVTGSLGGRFDHEAGNINVIHRF
STTRIILLSDECLIYLLPKTHYHEIHVNSSFEGPHCGLIPIGKPSMRTTTTGLQWDLNDTEMMFGGLVSTSNKVRAEKVTVESDEDLLWTISIKKD

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G02880 TPK1 thiamin pyrophosphokinase1 (.1... Lus10010283 0 1
AT3G45900 Ribonuclease P protein subunit... Lus10034732 1.7 0.8648
AT2G26970 Polynucleotidyl transferase, r... Lus10041292 2.0 0.8383
AT1G20830 MCD1 multiple chloroplast division ... Lus10030727 2.8 0.8299
AT4G17760 damaged DNA binding;exodeoxyri... Lus10030971 6.7 0.8209
AT1G28760 Uncharacterized conserved prot... Lus10034420 9.2 0.7875
AT1G02840 ATSRP34, SR1, S... Serine/Arginine-Rich Protein S... Lus10008218 12.6 0.8132
AT1G20830 MCD1 multiple chloroplast division ... Lus10013209 13.9 0.7989
AT4G22320 unknown protein Lus10032566 15.9 0.8036
AT3G54630 unknown protein Lus10030643 17.9 0.7383
AT1G75060 unknown protein Lus10028777 25.0 0.8162

Lus10010283 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.