Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G61980 65 / 4e-15 serine protease inhibitor, Kazal-type family protein (.1) AT4G01575 62 / 8e-14 serine protease inhibitor, Kazal-type family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10010286 [exp] 67 / 2e-16 AT4G01575 63 / 3e-14 serine protease inhibitor, Kazal-type family protein (.1) Lus10030166 [exp] 67 / 1e-15 AT4G01575 134 / 2e-41 serine protease inhibitor, Kazal-type family protein (.1) Lus10007864 [exp] 66 / 5e-15 AT4G01575 129 / 4e-39 serine protease inhibitor, Kazal-type family protein (.1) Lus10030164 [exp] 62 / 3e-14 AT4G01575 59 / 8e-13 serine protease inhibitor, Kazal-type family protein (.1) Lus10010287 [exp] 56 / 9e-12 AT4G01575 72 / 2e-17 serine protease inhibitor, Kazal-type family protein (.1) Lus10009866 [exp] 54 / 7e-11 AT4G01575 70 / 1e-16 serine protease inhibitor, Kazal-type family protein (.1) Lus10010094 [exp] 50 / 1e-09 AT4G01575 61 / 5e-13 serine protease inhibitor, Kazal-type family protein (.1) Lus10009865 [exp] 47 / 4e-08 AT4G01575 56 / 3e-11 serine protease inhibitor, Kazal-type family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G108700 [exp] 70 / 3e-17 AT3G61980 76 / 2e-19 serine protease inhibitor, Kazal-type family protein (.1) Potri.014G108600 [exp] 63 / 3e-14 AT4G01575 104 / 1e-29 serine protease inhibitor, Kazal-type family protein (.1) Potri.002G182800 [exp] 62 / 5e-14 AT4G01575 103 / 4e-29 serine protease inhibitor, Kazal-type family protein (.1) Potri.014G109000 [exp] 61 / 8e-14 AT3G61980 69 / 1e-16 serine protease inhibitor, Kazal-type family protein (.1) Potri.015G001800 [exp] 59 / 1e-12 AT4G01575 83 / 4e-21 serine protease inhibitor, Kazal-type family protein (.1) Potri.014G108900 [exp] 58 / 1e-12 AT3G61980 67 / 5e-16 serine protease inhibitor, Kazal-type family protein (.1) Potri.014G108800 [exp] 55 / 2e-11 AT4G01575 57 / 7e-12 serine protease inhibitor, Kazal-type family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10010285 pacid=23169492 polypeptide=Lus10010285 locus=Lus10010285.g ID=Lus10010285.BGIv1.0 annot-version=v1.0 ATGGCGCGTCCTTCTGTAATCAACATGGTGATGGTGGCCACAGTGATGTTCAGTATTGTGTCTGCCGCGTCCGCCGCAACTGGGCAGCTGGATTTGTGCG GCGCCCGCCGCGGTGCCGGAGTGAGTCGGCCAGCGCCTGGATGCGCGATCAGGTGCTTCCGGTACGACCCGGTTTGCGGGGCTAACGGCGTTACTTACGG GTGTGGTTGCCCCGATGCTGCTTGTGCCGGTGTCCGGGTTGTTAAGCTCGGGCCTTGTTAA
AA sequence Show only first row Show all	>Lus10010285 pacid=23169492 polypeptide=Lus10010285 locus=Lus10010285.g ID=Lus10010285.BGIv1.0 annot-version=v1.0 MARPSVINMVMVATVMFSIVSAASAATGQLDLCGARRGAGVSRPAPGCAIRCFRYDPVCGANGVTYGCGCPDAACAGVRVVKLGPC

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G61980			serine protease inhibitor, Kaz...		Lus10010285 [exp]	0	1
AT2G03530		ATUPS2, UPS2	ARABIDOPSIS THALIANA UREIDE PE...		Lus10037075 [exp]	2.6	0.9347
AT1G33030			O-methyltransferase family pro...		Lus10009442 [exp]	4.0	0.9279
AT2G29420		GST25, ATGSTU7	GLUTATHIONE S-TRANSFERASE 25, ...		Lus10001640 [exp]	6.0	0.9056
AT3G61220		SDR1	short-chain dehydrogenase/redu...		Lus10014688 [exp]	8.0	0.9096
AT1G22400		ATUGT85A1, UGT8...	ARABIDOPSIS THALIANA UDP-GLUCO...		Lus10039277 [exp]	8.6	0.8786
AT4G27450			Aluminium induced protein with...		Lus10033418 [exp]	8.9	0.9199
AT2G02040		NTR1, ATPTR2-B	NITRATE TRANSPORTER 1, ARABIDO...		Lus10011055 [exp]	10.0	0.8950
AT5G57260		CYP71B10	"cytochrome P450, family 71, s...		Lus10030189 [exp]	11.1	0.9214
AT5G39150			RmlC-like cupins superfamily p...		Lus10006543 [exp]	13.0	0.8944
AT1G55850		ATCSLE1	cellulose synthase like E1 (.1...		Lus10016625 [exp]	15.0	0.9198

Compare expression of checked genes

Lus10010285 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.