Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G01575 60 / 5e-13 serine protease inhibitor, Kazal-type family protein (.1) AT3G61980 53 / 1e-10 serine protease inhibitor, Kazal-type family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030164 [exp] 93 / 1e-26 AT4G01575 59 / 8e-13 serine protease inhibitor, Kazal-type family protein (.1) Lus10010285 [exp] 59 / 3e-13 AT3G61980 66 / 3e-15 serine protease inhibitor, Kazal-type family protein (.1) Lus10010287 [exp] 57 / 6e-12 AT4G01575 72 / 2e-17 serine protease inhibitor, Kazal-type family protein (.1) Lus10009866 [exp] 54 / 3e-11 AT4G01575 70 / 1e-16 serine protease inhibitor, Kazal-type family protein (.1) Lus10009865 [exp] 54 / 4e-11 AT4G01575 56 / 3e-11 serine protease inhibitor, Kazal-type family protein (.1) Lus10030166 [exp] 54 / 7e-11 AT4G01575 134 / 2e-41 serine protease inhibitor, Kazal-type family protein (.1) Lus10007864 [exp] 53 / 2e-10 AT4G01575 129 / 4e-39 serine protease inhibitor, Kazal-type family protein (.1) Lus10010094 [exp] 52 / 2e-10 AT4G01575 61 / 5e-13 serine protease inhibitor, Kazal-type family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G182800 [exp] 60 / 4e-13 AT4G01575 103 / 4e-29 serine protease inhibitor, Kazal-type family protein (.1) Potri.014G108700 [exp] 59 / 6e-13 AT3G61980 76 / 2e-19 serine protease inhibitor, Kazal-type family protein (.1) Potri.014G108600 [exp] 59 / 7e-13 AT4G01575 104 / 1e-29 serine protease inhibitor, Kazal-type family protein (.1) Potri.015G001800 [exp] 53 / 2e-10 AT4G01575 83 / 4e-21 serine protease inhibitor, Kazal-type family protein (.1) Potri.014G109000 [exp] 52 / 2e-10 AT3G61980 69 / 1e-16 serine protease inhibitor, Kazal-type family protein (.1) Potri.014G108900 [exp] 47 / 1e-08 AT3G61980 67 / 5e-16 serine protease inhibitor, Kazal-type family protein (.1) Potri.014G108800 [exp] 47 / 2e-08 AT4G01575 57 / 7e-12 serine protease inhibitor, Kazal-type family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10010286 pacid=23169499 polypeptide=Lus10010286 locus=Lus10010286.g ID=Lus10010286.BGIv1.0 annot-version=v1.0 ATGCCTGCGGCGATGTCGATGAAGAAACTGTGGGTGGTTATGATGATGTTGGTGGCGGTGCTTGTGGCGACGGCGTCGGCGCAAACTGATCCGTGTGCAG GTGTCTCTCCGCCGTTCGTCTGTCCATTCACCTGTACCCGACCCAACCCGGTCTGCGGGGCTAACGGCGTCACCTACAATTGCGGCTGCCCTGATGCCGC TTGCGCCTCCGTCCGAGTCGTCAGGACCGGGCGTTGTTAA
AA sequence Show only first row Show all	>Lus10010286 pacid=23169499 polypeptide=Lus10010286 locus=Lus10010286.g ID=Lus10010286.BGIv1.0 annot-version=v1.0 MPAAMSMKKLWVVMMMLVAVLVATASAQTDPCAGVSPPFVCPFTCTRPNPVCGANGVTYNCGCPDAACASVRVVRTGRC

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G01575			serine protease inhibitor, Kaz...		Lus10010286 [exp]	0	1
AT3G06490	MYB	BOS1, AtMYB108	BOTRYTIS-SUSCEPTIBLE1, myb dom...		Lus10037818 [exp]	1.0	0.9725
AT2G14095			unknown protein		Lus10001300 [exp]	7.9	0.9643
AT5G57510			unknown protein		Lus10028472 [exp]	9.6	0.9625
AT2G47485			unknown protein		Lus10009156 [exp]	11.3	0.9618
AT1G03220			Eukaryotic aspartyl protease f...		Lus10036343 [exp]	12.4	0.9540
AT2G47485			unknown protein		Lus10033571 [exp]	16.7	0.9521
AT5G26340		ATSTP13, MSS1, ...	SUGAR TRANSPORT PROTEIN 13, Ma...		Lus10010534 [exp]	18.2	0.9616
AT2G19130			S-locus lectin protein kinase ...		Lus10026390 [exp]	22.2	0.9465
AT4G30230			unknown protein		Lus10041416 [exp]	23.6	0.9192
					Lus10000527 [exp]	26.8	0.9550

Compare expression of checked genes

Lus10010286 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.