Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G08610 119 / 1e-37 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009864 [exp] 133 / 4e-43 AT3G08610 119 / 1e-37 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G140900 [exp] 92 / 1e-26 AT3G08610 88 / 3e-25 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10010288 pacid=23169504 polypeptide=Lus10010288 locus=Lus10010288.g ID=Lus10010288.BGIv1.0 annot-version=v1.0 ATGTCGTTGGTGTGGATGGAAGCTATGTTGCCGCTGGGAATCATCGGCGGTATGCTATGCGTTATGGGAAACTCGCAGTACTACATCCACAAAGCCTATC ACGGCCGGCCTAAGCACATCGGCAACGACATGTGGGACGTTGCCATGGAACGAAGGGACAAGAAGATCGTCGAGAATCTCGCCCCTTCTCCTTCCAATTA G
AA sequence Show only first row Show all	>Lus10010288 pacid=23169504 polypeptide=Lus10010288 locus=Lus10010288.g ID=Lus10010288.BGIv1.0 annot-version=v1.0 MSLVWMEAMLPLGIIGGMLCVMGNSQYYIHKAYHGRPKHIGNDMWDVAMERRDKKIVENLAPSPSN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G08610			unknown protein		Lus10010288 [exp]	0	1
AT1G55020		ATLOX1, LOX1	ARABIDOPSIS LIPOXYGENASE 1, li...		Lus10008202 [exp]	12.7	0.8098
AT3G46010		ATADF1, ADF1	actin depolymerizing factor 1 ...		Lus10025319 [exp]	18.4	0.7992
AT1G75950		UIP1, SKP1A, AT...	UFO INTERACTING PROTEIN 1, ARA...		Lus10013575 [exp]	18.5	0.8007
AT2G47030		VGDH1	Plant invertase/pectin methyle...		Lus10011760 [exp]	19.7	0.8308
AT3G25070		RIN4	RPM1 interacting protein 4 (.1...		Lus10006451 [exp]	22.4	0.8346
AT4G12570		UPL5	ubiquitin protein ligase 5 (.1...		Lus10003792 [exp]	29.4	0.8326
AT3G11590			unknown protein		Lus10013312 [exp]	41.0	0.8263
AT2G48030			DNAse I-like superfamily prote...		Lus10008177 [exp]	47.0	0.8240
AT3G14110		FLU	FLUORESCENT IN BLUE LIGHT, Tet...		Lus10037686 [exp]	57.1	0.7454
AT5G66580			unknown protein		Lus10019659 [exp]	59.1	0.7381

Compare expression of checked genes

Lus10010288 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.