Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G47500 269 / 2e-85 P-loop nucleoside triphosphate hydrolases superfamily protein with CH (Calponin Homology) domain (.1) AT5G27000 249 / 6e-78 KATD, ATK4 KINESIN-LIKE PROTEIN IN ARABIDOPSIS THALIANA D, kinesin 4 (.1) AT1G09170 248 / 1e-77 P-loop nucleoside triphosphate hydrolases superfamily protein with CH (Calponin Homology) domain (.1) AT3G44730 241 / 1e-74 AtKIN14h, ATKP1 ARABIDOPSIS KINESIN-LIKE PROTEIN 1, kinesin-like protein 1 (.1) AT3G10310 221 / 8e-68 P-loop nucleoside triphosphate hydrolases superfamily protein with CH (Calponin Homology) domain (.1) AT1G73860 213 / 6e-65 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT1G63640 213 / 1e-64 P-loop nucleoside triphosphate hydrolases superfamily protein with CH (Calponin Homology) domain (.1), P-loop nucleoside triphosphate hydrolases superfamily protein with CH (Calponin Homology) domain (.2) AT5G41310 212 / 1e-64 P-loop nucleoside triphosphate hydrolases superfamily protein with CH (Calponin Homology) domain (.1) AT1G18410 205 / 7e-62 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT5G27550 165 / 6e-48 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009851 [exp] 287 / 4e-92 AT2G47500 1245 / 0.0 P-loop nucleoside triphosphate hydrolases superfamily protein with CH (Calponin Homology) domain (.1) Lus10029865 [exp] 255 / 6e-80 AT5G27000 1014 / 0.0 KINESIN-LIKE PROTEIN IN ARABIDOPSIS THALIANA D, kinesin 4 (.1) Lus10015212 [exp] 239 / 9e-75 AT5G27000 924 / 0.0 KINESIN-LIKE PROTEIN IN ARABIDOPSIS THALIANA D, kinesin 4 (.1) Lus10001306 [exp] 239 / 3e-74 AT3G44730 1240 / 0.0 ARABIDOPSIS KINESIN-LIKE PROTEIN 1, kinesin-like protein 1 (.1) Lus10032897 [exp] 239 / 8e-74 AT3G44730 1302 / 0.0 ARABIDOPSIS KINESIN-LIKE PROTEIN 1, kinesin-like protein 1 (.1) Lus10032264 [exp] 217 / 6e-66 AT1G63640 991 / 0.0 P-loop nucleoside triphosphate hydrolases superfamily protein with CH (Calponin Homology) domain (.1), P-loop nucleoside triphosphate hydrolases superfamily protein with CH (Calponin Homology) domain (.2) Lus10035442 [exp] 216 / 7e-66 AT3G10310 864 / 0.0 P-loop nucleoside triphosphate hydrolases superfamily protein with CH (Calponin Homology) domain (.1) Lus10002007 [exp] 216 / 8e-66 AT1G63640 941 / 0.0 P-loop nucleoside triphosphate hydrolases superfamily protein with CH (Calponin Homology) domain (.1), P-loop nucleoside triphosphate hydrolases superfamily protein with CH (Calponin Homology) domain (.2) Lus10031058 [exp] 216 / 9e-66 AT3G10310 880 / 0.0 P-loop nucleoside triphosphate hydrolases superfamily protein with CH (Calponin Homology) domain (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G125700 [exp] 269 / 2e-85 AT2G47500 1218 / 0.0 P-loop nucleoside triphosphate hydrolases superfamily protein with CH (Calponin Homology) domain (.1) Potri.002G201000 [exp] 268 / 4e-85 AT2G47500 1237 / 0.0 P-loop nucleoside triphosphate hydrolases superfamily protein with CH (Calponin Homology) domain (.1) Potri.005G021100 [exp] 261 / 4e-82 AT2G47500 1051 / 0.0 P-loop nucleoside triphosphate hydrolases superfamily protein with CH (Calponin Homology) domain (.1) Potri.013G011500 [exp] 258 / 3e-81 AT5G27000 1081 / 0.0 KINESIN-LIKE PROTEIN IN ARABIDOPSIS THALIANA D, kinesin 4 (.1) Potri.001G467600 [exp] 244 / 9e-76 AT3G44730 1266 / 0.0 ARABIDOPSIS KINESIN-LIKE PROTEIN 1, kinesin-like protein 1 (.1) Potri.011G165200 [exp] 242 / 4e-75 AT3G44730 1300 / 0.0 ARABIDOPSIS KINESIN-LIKE PROTEIN 1, kinesin-like protein 1 (.1) Potri.006G048600 [exp] 217 / 1e-68 AT3G10310 395 / 1e-127 P-loop nucleoside triphosphate hydrolases superfamily protein with CH (Calponin Homology) domain (.1) Potri.001G104000 [exp] 213 / 9e-65 AT1G63640 1102 / 0.0 P-loop nucleoside triphosphate hydrolases superfamily protein with CH (Calponin Homology) domain (.1), P-loop nucleoside triphosphate hydrolases superfamily protein with CH (Calponin Homology) domain (.2) Potri.003G127800 [exp] 210 / 1e-63 AT1G63640 1065 / 0.0 P-loop nucleoside triphosphate hydrolases superfamily protein with CH (Calponin Homology) domain (.1), P-loop nucleoside triphosphate hydrolases superfamily protein with CH (Calponin Homology) domain (.2) Potri.012G056700 [exp] 201 / 2e-60 AT1G63640 857 / 0.0 P-loop nucleoside triphosphate hydrolases superfamily protein with CH (Calponin Homology) domain (.1), P-loop nucleoside triphosphate hydrolases superfamily protein with CH (Calponin Homology) domain (.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0023 [flax] [poplar] P-loop_NTPase PF00225 [flax] [poplar] Kinesin Kinesin motor domain
Representative CDS sequence Show only first row Show all	>Lus10010301 pacid=23169521 polypeptide=Lus10010301 locus=Lus10010301.g ID=Lus10010301.BGIv1.0 annot-version=v1.0 ATGGACGTGGGACATAGAAAGCGTGCAGTCGGTGCAACAGCGTTGAATGACCGTAGCAGCCGTTCTCATAGTTGCTTGACCGTTCACGTCCAAGGCAAAG ACTTGACCTCTGGAAATATCCTACGTGGCTGTATGCACCTGGTTGATCTTGCTGGGAGTGAAAGGGTAGATAAATCCGAGGTCAGAGGAGATAGGCTGAA AGAGGCACAGCACATTAATCGATCTCTGTCAGCTTTAGGAGATGTGATTCCTCCATTTGCCCAGAAGAATCCACACGTCCCTTACCGAAACAGCAAGCTT ACCCAACTGCTCCAAGATTCACTTGGAGGCCAAGCCAAGACACTAATGTTTGTTCACATAAGTCCCGAACCTGATGCTGTTGGAGAAACGATAAGCACAC TTAAGTTTGCAGAACGAGTAGCAACTGTCCCACTCCCCTTCCGATCTGCCAGATCGCTACCTTGA
AA sequence Show only first row Show all	>Lus10010301 pacid=23169521 polypeptide=Lus10010301 locus=Lus10010301.g ID=Lus10010301.BGIv1.0 annot-version=v1.0 MDVGHRKRAVGATALNDRSSRSHSCLTVHVQGKDLTSGNILRGCMHLVDLAGSERVDKSEVRGDRLKEAQHINRSLSALGDVIPPFAQKNPHVPYRNSKL TQLLQDSLGGQAKTLMFVHISPEPDAVGETISTLKFAERVATVPLPFRSARSLP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G47500			P-loop nucleoside triphosphate...		Lus10010301 [exp]	0	1
AT2G47500			P-loop nucleoside triphosphate...		Lus10010302 [exp]	1.0	0.9531
AT2G47500			P-loop nucleoside triphosphate...		Lus10009851 [exp]	1.4	0.9259
AT2G40480			Plant protein of unknown funct...		Lus10034211 [exp]	3.5	0.9028
AT1G35710			Protein kinase family protein ...		Lus10003612 [exp]	4.2	0.9164
AT5G48800			Phototropic-responsive NPH3 fa...		Lus10025928 [exp]	4.9	0.9043
AT4G13710			Pectin lyase-like superfamily ...		Lus10023679 [exp]	5.9	0.9034
AT5G48800			Phototropic-responsive NPH3 fa...		Lus10038169 [exp]	6.5	0.8654
AT2G45900			Phosphatidylinositol N-acetygl...		Lus10042850 [exp]	6.6	0.8855
AT1G75500		WAT1	Walls Are Thin 1 (.1.2)		Lus10024301 [exp]	6.7	0.8888
AT5G16720			Protein of unknown function, D...		Lus10004050 [exp]	7.1	0.8873

Compare expression of checked genes

Lus10010301 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.