Lus10010306 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10013419 123 / 2e-35 AT4G02270 118 / 3e-33 root hair specific 13 (.1)
Lus10005539 54 / 4e-09 AT4G02270 103 / 1e-27 root hair specific 13 (.1)
Lus10041926 52 / 2e-08 AT4G02270 100 / 5e-26 root hair specific 13 (.1)
Lus10008213 43 / 2e-05 AT2G47540 127 / 2e-36 Pollen Ole e 1 allergen and extensin family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G201800 49 / 2e-07 AT4G02270 118 / 1e-33 root hair specific 13 (.1)
Potri.002G201900 41 / 8e-05 AT2G47540 160 / 1e-50 Pollen Ole e 1 allergen and extensin family protein (.1)
PFAM info
Representative CDS sequence
>Lus10010306 pacid=23169495 polypeptide=Lus10010306 locus=Lus10010306.g ID=Lus10010306.BGIv1.0 annot-version=v1.0
ATGGCTTCCGTCCATTTCGCCCCCGCAGCATATGCCCTTCTGTTGTCCCTATCACTCGTCGGATCCATCGCCGGCGGCCAGAACTACCAACGCCCCGGCA
GCGCCACCCTCCAGAAGCCCAGTACTACCAGGCCTGAGCCCGTCAACTCACAACCCAATATTGGGTACGGCCCGAAGAGATCAGAAGAAGACGCATATCC
TATTGCAGTTGAAGGAACCGTCGTTTGCAAATCCGGCTCCGAATATGTTCCTATTAAAGCGATCTCCGATGAGGGATTGCAGCGTGGCGAGCGATGTGAG
CAAAGGGATCACGGATCGCTGCTGTCTTCGTATCGCATCCTCCACGAAGAGCGCAACAAGCTGTACCCGGTGGGTCCTTTCTTGTACACCCAGTCGCCTA
AGAGTACTCCTGCTGGGTACAGATAA
AA sequence
>Lus10010306 pacid=23169495 polypeptide=Lus10010306 locus=Lus10010306.g ID=Lus10010306.BGIv1.0 annot-version=v1.0
MASVHFAPAAYALLLSLSLVGSIAGGQNYQRPGSATLQKPSTTRPEPVNSQPNIGYGPKRSEEDAYPIAVEGTVVCKSGSEYVPIKAISDEGLQRGERCE
QRDHGSLLSSYRILHEERNKLYPVGPFLYTQSPKSTPAGYR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10010306 0 1
Lus10015230 1.0 0.9705
AT1G64870 unknown protein Lus10041678 2.4 0.9524
AT3G29970 B12D protein (.1) Lus10035132 3.5 0.9320
AT3G11480 BSMT1, ATBSMT1 S-adenosyl-L-methionine-depend... Lus10032299 4.2 0.9460
Lus10002237 5.9 0.9277
AT4G08850 Leucine-rich repeat receptor-l... Lus10004046 10.2 0.8660
AT3G14880 unknown protein Lus10013746 10.7 0.8102
AT5G12060 Plant self-incompatibility pro... Lus10023195 11.0 0.9024
AT5G17600 RING/U-box superfamily protein... Lus10008458 11.8 0.9024
AT4G10850 SWEET7, AtSWEET... Nodulin MtN3 family protein (.... Lus10023047 12.6 0.9024

Lus10010306 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.