Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G13480 45 / 2e-06 unknown protein AT1G55475 43 / 3e-06 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10013407 [exp] 129 / 6e-40 AT3G13480 45 / 1e-06 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G003300 [exp] 52 / 5e-09 AT3G13480 85 / 4e-21 unknown protein Potri.003G221800 [exp] 45 / 7e-07 AT3G13480 99 / 6e-27 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10010318 pacid=23169502 polypeptide=Lus10010318 locus=Lus10010318.g ID=Lus10010318.BGIv1.0 annot-version=v1.0 ATGAGGGTAGTGGCGTGCAACATCCACAGTCCTTTGCTTTGCTTGTGCAAGTGCAACCCATCAGATAGCATCTGCAGCCATCATCAAGTGCCAGCTTGTT CAATCTCATCAACTGATGAGAGCATTCAAGCCAAAGAGGAGAAGAAGGAAGGAGGAAAAGAGAAGAGGAGGAGTTGCATTGCAAACCAAGCTGATGATAA TAGGAAGAAGCAAAAGAAGAAAGTGCAGTGGATGGATTTGGTTGGGAAACCACTCTTTGAGATCAGAGAATTTGAACTCACCAGGTTGCTACTTGTTGAG CATCCATTCCCTTTGGAGACGTTCGGAATTGAAATTCCAGTCAATTCCGGCTGGAATTTCGAGGTTTAG
AA sequence Show only first row Show all	>Lus10010318 pacid=23169502 polypeptide=Lus10010318 locus=Lus10010318.g ID=Lus10010318.BGIv1.0 annot-version=v1.0 MRVVACNIHSPLLCLCKCNPSDSICSHHQVPACSISSTDESIQAKEEKKEGGKEKRRSCIANQADDNRKKQKKKVQWMDLVGKPLFEIREFELTRLLLVE HPFPLETFGIEIPVNSGWNFEV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G13480			unknown protein		Lus10010318 [exp]	0	1
AT2G37210		LOG3	LONELY GUY 3, lysine decarboxy...		Lus10002226 [exp]	2.2	0.8056
AT3G21870		CYCP2;1	cyclin p2;1 (.1)		Lus10027148 [exp]	2.8	0.8577
AT3G23610		DSPTP1	dual specificity protein phosp...		Lus10021940 [exp]	5.5	0.8116
AT4G22950	MADS	AGL19	AGAMOUS-like 19 (.1)		Lus10006715 [exp]	7.7	0.8344
AT1G35430			unknown protein		Lus10001289 [exp]	8.8	0.7560
AT4G39950		CYP79B2	"cytochrome P450, family 79, s...		Lus10023143 [exp]	8.8	0.7536
AT5G05260		CYP79A2	cytochrome p450 79a2 (.1)		Lus10023141 [exp]	13.7	0.7349
AT3G16500	AUX_IAA	IAA26, PAP1	indole-3-acetic acid inducible...		Lus10006842 [exp]	14.1	0.7721
AT5G03260		LAC11	laccase 11 (.1)		Lus10013800 [exp]	16.6	0.7536
AT1G78380		GST8, ATGSTU19	GLUTATHIONE TRANSFERASE 8, A. ...		Lus10042470 [exp]	23.7	0.7764

Compare expression of checked genes

Lus10010318 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.