Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G63140 37 / 0.0005 O-methyltransferase family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10038331 [exp] 89 / 2e-22 AT4G35160 197 / 8e-58 O-methyltransferase family protein (.1) Lus10006692 [exp] 72 / 2e-16 AT4G35160 152 / 2e-42 O-methyltransferase family protein (.1) Lus10006691 [exp] 66 / 1e-14 AT4G35150 150 / 1e-41 O-methyltransferase family protein (.1) Lus10032304 [exp] 65 / 5e-14 AT4G35160 170 / 2e-49 O-methyltransferase family protein (.1) Lus10007035 [exp] 50 / 8e-09 AT4G35160 137 / 7e-38 O-methyltransferase family protein (.1) Lus10018628 [exp] 50 / 9e-09 AT4G35160 192 / 7e-58 O-methyltransferase family protein (.1) Lus10017699 [exp] 39 / 0.0001 AT4G35150 204 / 2e-62 O-methyltransferase family protein (.1) Lus10033656 [exp] 37 / 0.0005 AT4G35150 211 / 8e-65 O-methyltransferase family protein (.1) Lus10024678 [exp] 37 / 0.0006 AT4G35160 64 / 2e-11 O-methyltransferase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G121300 [exp] 45 / 7e-07 AT4G35160 201 / 4e-61 O-methyltransferase family protein (.1) Potri.013G121800 [exp] 44 / 9e-07 AT4G35160 158 / 7e-46 O-methyltransferase family protein (.1) Potri.013G120800 [exp] 42 / 4e-06 AT4G35160 205 / 7e-63 O-methyltransferase family protein (.1) Potri.013G121400 [exp] 41 / 1e-05 AT4G35160 202 / 8e-62 O-methyltransferase family protein (.1) Potri.013G122400 [exp] 37 / 0.0003 AT4G35160 188 / 2e-56 O-methyltransferase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0063 [flax] [poplar] NADP_Rossmann PF00891 [flax] [poplar] Methyltransf_2 O-methyltransferase domain
Representative CDS sequence Show only first row Show all	>Lus10010327 pacid=23169476 polypeptide=Lus10010327 locus=Lus10010327.g ID=Lus10010327.BGIv1.0 annot-version=v1.0 ATGATGGATCCGTGGCGACATCTGAGCCGTTGGTTTCGGATCGACGCAAACCCGGCAGAGCAACCGCCGTTTAGCATGGCTCACGGCGGCAAGAAGATCT ACGAACTTGTATCCGAAGACGCACGATTTGCGGAGATTTTTAATGACGGGTTAGGGCGGAACAGCTGGCTGTTCAGCAAGGCATTCGTCGTGAAGGCGGC GGCATTAAAACGCTTGTAG
AA sequence Show only first row Show all	>Lus10010327 pacid=23169476 polypeptide=Lus10010327 locus=Lus10010327.g ID=Lus10010327.BGIv1.0 annot-version=v1.0 MMDPWRHLSRWFRIDANPAEQPPFSMAHGGKKIYELVSEDARFAEIFNDGLGRNSWLFSKAFVVKAAALKRL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10010327 [exp]	0	1
AT1G70830		MLP28	MLP-like protein 28 (.1.2.3.4....		Lus10012466 [exp]	4.6	0.8049
AT1G21150			Mitochondrial transcription te...		Lus10039174 [exp]	5.1	0.8479
AT2G36540			Haloacid dehalogenase-like hyd...		Lus10016365 [exp]	8.0	0.7684
					Lus10021139 [exp]	8.4	0.8330
AT4G17030		ATHEXPBETA3.1, ...	expansin-like B1 (.1)		Lus10001244 [exp]	13.5	0.5980
AT1G59840		CCB4	cofactor assembly of complex C...		Lus10010732 [exp]	14.5	0.7442
					Lus10021851 [exp]	19.1	0.7424
AT1G02520		MDR8, ABCB11, P...	multi-drug resistance 8, ATP-b...		Lus10004530 [exp]	20.7	0.7424
AT3G19620			Glycosyl hydrolase family prot...		Lus10002127 [exp]	21.4	0.7390
					Lus10008791 [exp]	22.1	0.7424

Compare expression of checked genes

Lus10010327 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.