Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G55530 72 / 8e-16 RING/U-box superfamily protein (.1) AT3G13430 67 / 5e-14 RING/U-box superfamily protein (.1.2.3) AT4G26400 66 / 7e-14 RING/U-box superfamily protein (.1.2) AT5G56340 66 / 7e-14 ATCRT1 RING/U-box superfamily protein (.1) AT3G19950 62 / 2e-12 RING/U-box superfamily protein (.1) AT5G59550 62 / 2e-12 zinc finger (C3HC4-type RING finger) family protein (.1) AT3G46620 60 / 2e-11 zinc finger (C3HC4-type RING finger) family protein (.1) AT1G26800 57 / 6e-11 RING/U-box superfamily protein (.1) AT5G60820 57 / 1e-10 RING/U-box superfamily protein (.1) AT5G08139 56 / 3e-10 RING/U-box superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10013397 [exp] 116 / 4e-32 AT5G56340 330 / 5e-111 RING/U-box superfamily protein (.1) Lus10002637 [exp] 67 / 5e-14 AT1G55530 257 / 4e-82 RING/U-box superfamily protein (.1) Lus10020258 [exp] 67 / 5e-14 AT1G19800 469 / 4e-161 ATP-binding cassette I14, trigalactosyldiacylglycerol 1 (.1.2.3) Lus10030464 [exp] 63 / 8e-13 AT1G26800 181 / 3e-57 RING/U-box superfamily protein (.1) Lus10012819 [exp] 62 / 1e-12 AT1G26800 182 / 6e-58 RING/U-box superfamily protein (.1) Lus10036757 [exp] 61 / 2e-12 AT1G26800 127 / 1e-36 RING/U-box superfamily protein (.1) Lus10037170 [exp] 61 / 3e-12 AT1G26800 128 / 5e-37 RING/U-box superfamily protein (.1) Lus10017383 [exp] 59 / 4e-12 AT3G19950 127 / 8e-37 RING/U-box superfamily protein (.1) Lus10010179 [exp] 59 / 2e-11 AT3G19950 285 / 6e-96 RING/U-box superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G001500 [exp] 81 / 4e-19 AT5G56340 323 / 2e-108 RING/U-box superfamily protein (.1) Potri.003G223200 [exp] 79 / 2e-18 AT5G56340 301 / 3e-99 RING/U-box superfamily protein (.1) Potri.013G060500 [exp] 67 / 4e-14 AT1G55530 207 / 2e-64 RING/U-box superfamily protein (.1) Potri.019G032500 [exp] 65 / 2e-13 AT5G56340 177 / 1e-51 RING/U-box superfamily protein (.1) Potri.005G090500 [exp] 61 / 7e-12 AT3G19950 279 / 4e-93 RING/U-box superfamily protein (.1) Potri.010G168300 [exp] 59 / 2e-11 AT1G26800 195 / 4e-63 RING/U-box superfamily protein (.1) Potri.015G028400 [exp] 59 / 2e-11 AT3G19950 256 / 2e-83 RING/U-box superfamily protein (.1) Potri.001G243300 [exp] 59 / 3e-11 AT3G46620 239 / 8e-76 zinc finger (C3HC4-type RING finger) family protein (.1) Potri.007G074014 [exp] 59 / 4e-11 AT3G19950 278 / 5e-93 RING/U-box superfamily protein (.1) Potri.012G036700 [exp] 58 / 7e-11 AT3G19950 273 / 5e-90 RING/U-box superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0229 [flax] [poplar] RING PF00097 [flax] [poplar] zf-C3HC4 Zinc finger, C3HC4 type (RING finger)
Representative CDS sequence Show only first row Show all	>Lus10010328 pacid=23169477 polypeptide=Lus10010328 locus=Lus10010328.g ID=Lus10010328.BGIv1.0 annot-version=v1.0 ATGCCCTGCAAGCATAAGTTCCATAGTGGGTGCATACTTCCATGGCTGGAGCTTCATAGTTCTTGTCCAGTATGTAGGTTTCAGCTTCCTGCAGAAAAGT CCACGCTTGATCCCGAGATCTCTAGTACAAGCACCACAGAGACATCAACTGAAGAAGAGAACCATGAGGGTACGAGTAACAACGAGGGTGGTGAAGATGC AGAAGGGGAAGGGAGAAATGGAGGTGGGAGAAGGTTTACTCTTCCGTGGCCCTTCAGTGGCTTATTCTCCTCTTCAAACTCGAGCAATCCTTCGACAACA CCATCGTCTTCTTCAGCCAACGGCCATGAGGGGACAAGTTCTCAAACAGACGACAACTGA
AA sequence Show only first row Show all	>Lus10010328 pacid=23169477 polypeptide=Lus10010328 locus=Lus10010328.g ID=Lus10010328.BGIv1.0 annot-version=v1.0 MPCKHKFHSGCILPWLELHSSCPVCRFQLPAEKSTLDPEISSTSTTETSTEEENHEGTSNNEGGEDAEGEGRNGGGRRFTLPWPFSGLFSSSNSSNPSTT PSSSSANGHEGTSSQTDDN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G56340		ATCRT1	RING/U-box superfamily protein...		Lus10010328 [exp]	0	1
AT5G64920		CIP8	COP1-interacting protein 8 (.1...		Lus10031422 [exp]	2.8	0.8270
AT3G05010			Protein of unknown function, t...		Lus10033835 [exp]	4.7	0.8304
AT4G05320		UBQ10	polyubiquitin 10 (.1.2.3.4.5.6...		Lus10018367 [exp]	4.9	0.8178
AT4G35220			Cyclase family protein (.1)		Lus10014092 [exp]	6.7	0.8192
AT5G22250		AtCAF1b	CCR4- associated factor 1b, Po...		Lus10021304 [exp]	9.5	0.8022
AT3G06170			Serinc-domain containing serin...		Lus10004430 [exp]	11.3	0.8112
AT5G16370		AAE5	acyl activating enzyme 5 (.1)		Lus10039161 [exp]	12.0	0.7974
AT2G01150		RHA2B	RING-H2 finger protein 2B (.1)		Lus10013475 [exp]	12.2	0.8155
AT3G48090		ATEDS1, EDS1	enhanced disease susceptibilit...		Lus10036644 [exp]	13.2	0.8122
AT5G03370			acylphosphatase family (.1)		Lus10026533 [exp]	13.6	0.8141

Compare expression of checked genes

Lus10010328 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.