Lus10010339 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G02080 220 / 5e-75 Ribosomal protein S19e family protein (.1)
AT5G61170 217 / 1e-73 Ribosomal protein S19e family protein (.1)
AT5G15520 214 / 1e-72 Ribosomal protein S19e family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10000095 313 / 9e-112 AT3G02080 219 / 1e-74 Ribosomal protein S19e family protein (.1)
Lus10013188 239 / 3e-82 AT3G02080 259 / 2e-90 Ribosomal protein S19e family protein (.1)
Lus10021865 237 / 5e-82 AT3G02080 216 / 7e-74 Ribosomal protein S19e family protein (.1)
Lus10030702 235 / 4e-81 AT3G02080 215 / 2e-73 Ribosomal protein S19e family protein (.1)
Lus10032992 234 / 6e-81 AT3G02080 218 / 1e-74 Ribosomal protein S19e family protein (.1)
Lus10033532 230 / 7e-79 AT3G02080 258 / 3e-90 Ribosomal protein S19e family protein (.1)
Lus10020836 229 / 2e-78 AT3G02080 258 / 5e-90 Ribosomal protein S19e family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.015G056100 217 / 9e-74 AT5G61170 269 / 2e-94 Ribosomal protein S19e family protein (.1)
Potri.004G118800 216 / 3e-73 AT5G61170 269 / 2e-94 Ribosomal protein S19e family protein (.1)
Potri.017G092200 214 / 1e-72 AT5G61170 270 / 5e-95 Ribosomal protein S19e family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0123 HTH PF01090 Ribosomal_S19e Ribosomal protein S19e
Representative CDS sequence
>Lus10010339 pacid=23169503 polypeptide=Lus10010339 locus=Lus10010339.g ID=Lus10010339.BGIv1.0 annot-version=v1.0
ATGGATTCGCTTTCGGACAAGGTCAGATTCCGGACTTGGGTTTGCACCAAATGGGATCCGCGATCTAAGCCCAGCATTGTTGTAGCCGGACCGGGCAAGG
AAAACATAAAGATAGAGCTTCCCCCATGGACTGATATTGTGAAGACTGGGAAGTTGAAGGAGCTTGCACCTTACGACCCTGACTGGTATTACATCAGAGC
TGCCTCAATGGCGAGAAAGGTATACCTTAGAGGCGGCCTTGGTGTTGGTGCATTCCGGAGAATTTATGGCGGGAGCAAAAGGAATGGAAGCCGCCCGCCC
CATTTCTGCAAAAGCAGTGGTGCTGTCGCCCGTCACATTCTTCAACAATTGGAGAAGGTTAACATCGTTGAAGTTGATACCAACGGTGGAAGGAAGATTA
CTTCAAATGGCCAGAGGGATTTGGATCAAGTTGCTGGACGGGTTATTGTTGTTGCTCCTTGA
AA sequence
>Lus10010339 pacid=23169503 polypeptide=Lus10010339 locus=Lus10010339.g ID=Lus10010339.BGIv1.0 annot-version=v1.0
MDSLSDKVRFRTWVCTKWDPRSKPSIVVAGPGKENIKIELPPWTDIVKTGKLKELAPYDPDWYYIRAASMARKVYLRGGLGVGAFRRIYGGSKRNGSRPP
HFCKSSGAVARHILQQLEKVNIVEVDTNGGRKITSNGQRDLDQVAGRVIVVAP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G02080 Ribosomal protein S19e family ... Lus10010339 0 1
AT3G02080 Ribosomal protein S19e family ... Lus10021865 1.0 0.9525
AT3G02080 Ribosomal protein S19e family ... Lus10000095 1.4 0.9148
Lus10029394 5.7 0.8934
AT4G16720 Ribosomal protein L23/L15e fam... Lus10000165 8.3 0.9127
AT5G19750 Peroxisomal membrane 22 kDa (M... Lus10012098 10.2 0.8422
AT2G47640 Small nuclear ribonucleoprotei... Lus10026556 11.7 0.8964
AT1G61010 CPSF73-I cleavage and polyadenylation s... Lus10001372 14.7 0.8577
AT4G25740 RNA binding Plectin/S10 domain... Lus10027519 15.0 0.8612
AT3G61110 ARS27A ribosomal protein S27 (.1) Lus10035128 16.4 0.8489
AT2G34480 Ribosomal protein L18ae/LX fam... Lus10040332 17.5 0.9126

Lus10010339 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.