Lus10010345 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G22450 139 / 2e-43 ATCOX6B2, COX6B CYTOCHROME C OXIDASE 6B2, cytochrome C oxidase 6B (.1)
AT4G28060 135 / 2e-43 Cytochrome c oxidase, subunit Vib family protein (.1)
AT5G57815 135 / 3e-43 Cytochrome c oxidase, subunit Vib family protein (.1)
AT1G32710 71 / 2e-17 Cytochrome c oxidase, subunit Vib family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10036478 154 / 1e-50 AT1G22450 146 / 2e-46 CYTOCHROME C OXIDASE 6B2, cytochrome C oxidase 6B (.1)
Lus10008716 144 / 3e-45 AT1G22450 173 / 4e-55 CYTOCHROME C OXIDASE 6B2, cytochrome C oxidase 6B (.1)
Lus10040123 114 / 2e-34 AT1G22450 121 / 9e-36 CYTOCHROME C OXIDASE 6B2, cytochrome C oxidase 6B (.1)
Lus10020941 110 / 2e-31 AT1G22450 138 / 9e-41 CYTOCHROME C OXIDASE 6B2, cytochrome C oxidase 6B (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G162100 145 / 7e-46 AT1G22450 152 / 4e-47 CYTOCHROME C OXIDASE 6B2, cytochrome C oxidase 6B (.1)
Potri.018G099900 139 / 9e-45 AT5G57815 147 / 3e-48 Cytochrome c oxidase, subunit Vib family protein (.1)
Potri.002G100000 113 / 3e-33 AT1G22450 123 / 2e-35 CYTOCHROME C OXIDASE 6B2, cytochrome C oxidase 6B (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0351 CHCH PF02297 COX6B Cytochrome oxidase c subunit VIb
Representative CDS sequence
>Lus10010345 pacid=23169489 polypeptide=Lus10010345 locus=Lus10010345.g ID=Lus10010345.BGIv1.0 annot-version=v1.0
ATGGCCGATCTTGCCACTGCTGACGCTCTCTCCTCTCTCGAGCTGAAGACAGCACCAGCTGATTACCGTTTCCCGACGACCAACCAAACAAGGCACTGCT
TTACTCGTTATATTGAGTTCCATAGGTGCGTTGCTGCAAAGGGAGAAGATGCTTCAGACTGCCAGAAGTTCTCCAAATACTATCGCTCTCTTTGCCCTGG
TGAATGGGTGGAGAAATGGAATGAGCAGAGGGAGAATGGCACGTTTGCAGGACCTCTGTAG
AA sequence
>Lus10010345 pacid=23169489 polypeptide=Lus10010345 locus=Lus10010345.g ID=Lus10010345.BGIv1.0 annot-version=v1.0
MADLATADALSSLELKTAPADYRFPTTNQTRHCFTRYIEFHRCVAAKGEDASDCQKFSKYYRSLCPGEWVEKWNEQRENGTFAGPL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G22450 ATCOX6B2, COX6B CYTOCHROME C OXIDASE 6B2, cyto... Lus10010345 0 1
AT2G21870 MGP1 MALE GAMETOPHYTE DEFECTIVE 1, ... Lus10005794 1.0 0.8913
AT1G22450 ATCOX6B2, COX6B CYTOCHROME C OXIDASE 6B2, cyto... Lus10036478 4.9 0.8422
AT5G47890 NADH-ubiquinone oxidoreductase... Lus10040122 6.7 0.8425
AT5G51510 unknown protein Lus10038916 7.3 0.7794
AT4G27745 Yippee family putative zinc-bi... Lus10033226 7.7 0.8508
AT5G18900 2-oxoglutarate (2OG) and Fe(II... Lus10012014 8.8 0.8186
AT3G25220 FKBP15-1 FK506-binding protein 15 kD-1 ... Lus10002339 10.2 0.8144
AT2G38760 ANN3, ANNAT3 annexin 3 (.1) Lus10039550 17.3 0.8354
AT5G09430 alpha/beta-Hydrolases superfam... Lus10033451 20.0 0.8505
AT1G71190 TTN4, SAG18 senescence associated gene 18 ... Lus10001354 20.1 0.7932

Lus10010345 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.