Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G78310 53 / 3e-09 VQ motif-containing protein (.1) AT2G35230 41 / 5e-05 IKU1 HAIKU1, VQ motif-containing protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10036480 [exp] 75 / 9e-17 AT1G78310 95 / 8e-22 VQ motif-containing protein (.1) Lus10010346 [exp] 53 / 3e-09 AT1G78310 158 / 8e-47 VQ motif-containing protein (.1) Lus10036479 [exp] 53 / 4e-09 AT1G78310 153 / 6e-45 VQ motif-containing protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G099900 [exp] 54 / 2e-09 AT1G78310 141 / 2e-39 VQ motif-containing protein (.1) Potri.005G162300 [exp] 51 / 2e-08 AT1G78310 142 / 3e-40 VQ motif-containing protein (.1) Potri.001G142400 [exp] 42 / 3e-05 AT2G35230 96 / 5e-22 HAIKU1, VQ motif-containing protein (.1.2) Potri.003G091800 [exp] 42 / 3e-05 AT1G32610 71 / 1e-13 hydroxyproline-rich glycoprotein family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF05678 [flax] [poplar] VQ VQ motif
Representative CDS sequence Show only first row Show all	>Lus10010347 pacid=23169487 polypeptide=Lus10010347 locus=Lus10010347.g ID=Lus10010347.BGIv1.0 annot-version=v1.0 ATGGAGCGGCAATCGTCAGTTGACTCATTCAACAGCAGCGGACGAGATCAGTACCTGAAGAACTTGAACAAGCAGTCTCAGAAGATCTCGAAACCTAGCT TCTCCTCCTCCTCCGCCGTTGTCAACTCTAGAAAGCCCTCTCCTTCTCCCTTTGACCAACAGCAGCAGCCACCGCCGCCTAATTTCAATCCTCCTAATCC GACGGCCCAGAATCAGAACCAACCGATGGTGTACAACATCAACAAGAACGATTTCCGAGATGTGGTCCAGCGCCTCACCGGATCCCCCGCCCACGACCGC TCCTCTTCAAATCCTCCGCCCCCGCCCGCCTCCGCCGCCCACCCCCCCACTCTCACGCACTAA
AA sequence Show only first row Show all	>Lus10010347 pacid=23169487 polypeptide=Lus10010347 locus=Lus10010347.g ID=Lus10010347.BGIv1.0 annot-version=v1.0 MERQSSVDSFNSSGRDQYLKNLNKQSQKISKPSFSSSSAVVNSRKPSPSPFDQQQQPPPPNFNPPNPTAQNQNQPMVYNINKNDFRDVVQRLTGSPAHDR SSSNPPPPPASAAHPPTLTH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G78310			VQ motif-containing protein (....		Lus10010347 [exp]	0	1
AT2G01190		PDE331	PIGMENT DEFECTIVE 331, Octicos...		Lus10013486 [exp]	6.6	0.8398
AT3G24550		ATPERK1	proline-rich extensin-like rec...		Lus10011098 [exp]	11.3	0.8576
AT4G11740		SAY1	Ubiquitin-like superfamily pro...		Lus10029591 [exp]	11.3	0.8509
AT2G34500		CYP710A1	cytochrome P450, family 710, s...		Lus10028129 [exp]	23.7	0.8103
AT5G20730	ARF	MSG1, IAA21, BI...	MASSUGU 1, indole-3-acetic aci...		Lus10017681 [exp]	25.7	0.8053
AT2G01600			ENTH/ANTH/VHS superfamily prot...		Lus10007933 [exp]	27.2	0.7852
AT1G32540		LOL1	lsd one like 1 (.1.2.3)		Lus10038409 [exp]	35.3	0.7996
AT1G68690		AtPERK9	proline-rich extensin-like rec...		Lus10017898 [exp]	62.8	0.7853
AT5G14540			Protein of unknown function (D...		Lus10032138 [exp]	63.2	0.8107
AT2G01190		PDE331	PIGMENT DEFECTIVE 331, Octicos...		Lus10007952 [exp]	63.2	0.7718

Compare expression of checked genes

Lus10010347 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.