Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G65910 71 / 6e-15 NAC ANAC028 NAC domain containing protein 28 (.1) AT5G17260 70 / 1e-14 NAC ANAC086 NAC domain containing protein 86 (.1) AT1G32510 69 / 1e-14 NAC ANAC011 NAC domain containing protein 11 (.1) AT5G22290 68 / 5e-14 NAC FSQ6, FAN, ANAC089 fructose-sensing quantitative trait locus 6, NAC domain containing protein 89 (.1) AT3G17730 67 / 6e-14 NAC ANAC057 NAC domain containing protein 57 (.1) AT3G03200 67 / 7e-14 NAC ANAC045 NAC domain containing protein 45 (.1) AT3G44290 66 / 2e-13 NAC ANAC060 NAC domain containing protein 60 (.1) AT1G52890 64 / 9e-13 NAC ANAC019 NAC domain containing protein 19 (.1) AT3G15500 64 / 1e-12 NAC ATNAC3, ANAC055 NAC domain containing protein 55, NAC domain containing protein 3 (.1) AT2G27300 64 / 1e-12 NAC NTL8, ANAC040 Arabidopsis NAC domain containing protein 40, NTM1-like 8 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10010037 [exp] 282 / 2e-97 AT1G65910 102 / 4e-24 NAC domain containing protein 28 (.1) Lus10013964 [exp] 69 / 2e-14 AT1G61110 225 / 2e-71 NAC domain containing protein 25 (.1) Lus10013316 [exp] 68 / 5e-14 AT5G22290 285 / 5e-94 fructose-sensing quantitative trait locus 6, NAC domain containing protein 89 (.1) Lus10005204 [exp] 67 / 2e-13 AT5G22290 292 / 8e-97 fructose-sensing quantitative trait locus 6, NAC domain containing protein 89 (.1) Lus10028713 [exp] 66 / 2e-13 AT1G34190 392 / 2e-130 NAC domain containing protein 17 (.1) Lus10036773 [exp] 66 / 3e-13 AT1G69490 318 / 1e-109 Arabidopsis NAC domain containing protein 29, NAC-like, activated by AP3/PI (.1) Lus10037156 [exp] 66 / 3e-13 AT1G69490 318 / 2e-109 Arabidopsis NAC domain containing protein 29, NAC-like, activated by AP3/PI (.1) Lus10042284 [exp] 65 / 4e-13 AT3G17730 348 / 1e-121 NAC domain containing protein 57 (.1) Lus10026373 [exp] 65 / 4e-13 AT3G17730 348 / 2e-121 NAC domain containing protein 57 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G025700 [exp] 175 / 3e-55 AT1G69490 88 / 3e-20 Arabidopsis NAC domain containing protein 29, NAC-like, activated by AP3/PI (.1) Potri.001G144400 [exp] 70 / 1e-14 AT4G17980 318 / 2e-108 NAC domain containing protein 71 (.1) Potri.003G089800 [exp] 67 / 7e-14 AT4G17980 319 / 6e-109 NAC domain containing protein 71 (.1) Potri.015G004100 [exp] 67 / 1e-13 AT3G49530 309 / 5e-99 NTM1 \(NAC WITH TRANSMEMBRANE MOTIF 1\)-LIKE 6, NAC domain containing protein 62 (.1) Potri.006G209200 [exp] 66 / 2e-13 AT5G22380 241 / 3e-80 NAC domain containing protein 90 (.1) Potri.007G065400 [exp] 66 / 2e-13 AT1G56010 337 / 4e-116 Arabidopsis NAC domain containing protein 22, Arabidopsis NAC domain containing protein 21, NAC domain containing protein 1 (.1.2) Potri.009G019200 [exp] 64 / 4e-13 AT3G44350 257 / 1e-86 NAC domain containing protein 61 (.1.2) Potri.010G174600 [exp] 65 / 5e-13 AT1G54330 290 / 2e-97 NAC domain containing protein 20 (.1) Potri.008G081500 [exp] 64 / 9e-13 AT1G54330 316 / 1e-107 NAC domain containing protein 20 (.1) Potri.014G108000 [exp] 64 / 9e-13 AT4G35580 176 / 6e-52 NAC transcription factor-like 9 (.1.2.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02365 [flax] [poplar] NAM No apical meristem (NAM) protein
Representative CDS sequence Show only first row Show all	>Lus10010371 pacid=23174869 polypeptide=Lus10010371 locus=Lus10010371.g ID=Lus10010371.BGIv1.0 annot-version=v1.0 ATGTCGTTTGATCTTCCGTCGGGTTGTCAGTTCTACCCTTCCGACCAGCAGCTTCTATGTTACTATCTTACCAATAAGAACCATGGGGATGGCGCTGGCT GCAATCAACAGGAAGAAACCAATGGATACGATTTGATAAAGGAGCTCGACTTGTATGATCACGAGCCGTTTGATTTGCCTGAACACTCATGCTATTCGTT TGGGCCCAAGGGGAGGAAAACACACTGGTTTTGCTATGCGAAAATTAGGGTTTCCAAGGAAGAAAACAGGGGAAATAGGAGCCGAGCCAAGGGAGGGTAT TGGAGAAGGTTAGGTAAGGTTTCAGACGTGGTGGAAAGTGGCTGGAATAGTGCGATCGTCGGTACCAGAACTCAGTTTGTCTTTTATTTGGGGAATTCCG TGAAGAGTGCAACCAGGACTGAATGGATTTAG
AA sequence Show only first row Show all	>Lus10010371 pacid=23174869 polypeptide=Lus10010371 locus=Lus10010371.g ID=Lus10010371.BGIv1.0 annot-version=v1.0 MSFDLPSGCQFYPSDQQLLCYYLTNKNHGDGAGCNQQEETNGYDLIKELDLYDHEPFDLPEHSCYSFGPKGRKTHWFCYAKIRVSKEENRGNRSRAKGGY WRRLGKVSDVVESGWNSAIVGTRTQFVFYLGNSVKSATRTEWI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G17260	NAC	ANAC086	NAC domain containing protein ...		Lus10010371 [exp]	0	1
AT5G23540			Mov34/MPN/PAD-1 family protein...		Lus10011717 [exp]	3.0	0.8813
AT5G23540			Mov34/MPN/PAD-1 family protein...		Lus10011716 [exp]	4.2	0.8588
AT1G49480	B3	REM19, RTV1	related to vernalization1 1 (....		Lus10009214 [exp]	4.9	0.8176
AT3G07190			B-cell receptor-associated pro...		Lus10025914 [exp]	5.7	0.8361
AT1G65660		SMP1	SWELLMAP 1, Pre-mRNA splicing ...		Lus10007479 [exp]	6.9	0.8417
AT5G47760		ATPK5, ATPGLP2	2-phosphoglycolate phosphatase...		Lus10033024 [exp]	8.7	0.7796
AT5G62810		ATPEX14, PED2, ...	PEROXISOME DEFECTIVE 2, peroxi...		Lus10039935 [exp]	11.2	0.8172
AT2G27030		CAM5, CAM2, ACA...	calmodulin 5 (.1.2.3)		Lus10010386 [exp]	12.4	0.7916
AT5G55500		ATXYLT	"beta-1,2-xylosyltransferase",...		Lus10014902 [exp]	13.0	0.8111
AT3G51250			Senescence/dehydration-associa...		Lus10028439 [exp]	13.0	0.7897

Compare expression of checked genes

Lus10010371 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.