Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G13570 46 / 1e-06 F-box/RNI-like superfamily protein (.1) AT1G55030 40 / 0.0001 RNI-like superfamily protein (.1) AT1G69630 39 / 0.0006 F-box/RNI-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028368 [exp] 152 / 9e-49 AT1G13570 69 / 1e-14 F-box/RNI-like superfamily protein (.1) Lus10028366 [exp] 154 / 2e-47 AT1G13570 98 / 4e-23 F-box/RNI-like superfamily protein (.1) Lus10041818 [exp] 152 / 1e-45 AT1G13570 154 / 3e-42 F-box/RNI-like superfamily protein (.1) Lus10035151 [exp] 87 / 6e-21 AT5G51170 306 / 7e-101 unknown protein Lus10006342 [exp] 86 / 2e-20 AT5G51920 432 / 4e-144 Pyridoxal phosphate (PLP)-dependent transferases superfamily protein (.1) Lus10002959 [exp] 79 / 3e-18 AT1G13570 112 / 4e-28 F-box/RNI-like superfamily protein (.1) Lus10006346 [exp] 78 / 1e-17 AT1G13570 140 / 2e-37 F-box/RNI-like superfamily protein (.1) Lus10040760 [exp] 78 / 1e-17 AT1G13570 157 / 3e-43 F-box/RNI-like superfamily protein (.1) Lus10011048 [exp] 61 / 6e-12 AT1G13570 127 / 2e-32 F-box/RNI-like superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G039700 [exp] 53 / 6e-09 AT1G13570 265 / 7e-85 F-box/RNI-like superfamily protein (.1) Potri.010G134200 [exp] 52 / 1e-08 AT1G13570 526 / 0.0 F-box/RNI-like superfamily protein (.1) Potri.002G132400 [exp] 51 / 2e-08 AT1G13570 251 / 3e-79 F-box/RNI-like superfamily protein (.1) Potri.017G107600 [exp] 44 / 7e-06 AT1G13570 196 / 4e-58 F-box/RNI-like superfamily protein (.1) Potri.011G024200 [exp] 40 / 0.0001 AT4G26340 105 / 1e-24 F-box/RNI-like/FBD-like domains-containing protein (.1) Potri.011G121500 [exp] 40 / 0.0002 AT4G14103 142 / 6e-38 F-box/RNI-like superfamily protein (.1.2) Potri.011G098700 [exp] 38 / 0.0007 AT1G80960 86 / 6e-18 F-box and Leucine Rich Repeat domains containing protein (.1.2.3)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10010381 pacid=23146075 polypeptide=Lus10010381 locus=Lus10010381.g ID=Lus10010381.BGIv1.0 annot-version=v1.0 ATGACTTGGTTGATTCTAGTGTACGGTGAGATGCCAGCAGATGAATCAGCTTCAAGACTCCACAGACGTGATAGAGAAAATCCTGACATGGACGCTGCTA GAACCAGCATCTTATCAAGAGTCTGGCAGCATCATTGGAGAAGCATTCCTCAACTCGTGTTGGATGCCAATTTCCTAGCTGAATTCAACAACGGTCACTT GCTGGACAAGAAAAAGGTAATGCTTAGCATTTACAGAGCTCTGATGGCACATGATGGCCCCATAACCAAACTCAAGCTGAACATTCCTGGATTGAACCCA TCTTCTCATATTGATCTTTTGATGCCTTGCCTCGCGACCAAACAAATCCAAGAGCTAACCCTTTACGATGACGACTAA
AA sequence Show only first row Show all	>Lus10010381 pacid=23146075 polypeptide=Lus10010381 locus=Lus10010381.g ID=Lus10010381.BGIv1.0 annot-version=v1.0 MTWLILVYGEMPADESASRLHRRDRENPDMDAARTSILSRVWQHHWRSIPQLVLDANFLAEFNNGHLLDKKKVMLSIYRALMAHDGPITKLKLNIPGLNP SSHIDLLMPCLATKQIQELTLYDDD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G04230			FBD, F-box and Leucine Rich Re...		Lus10010381 [exp]	0	1

Compare expression of checked genes

Lus10010381 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.