Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019586 [exp] 171 / 1e-56 ND / Lus10013091 [exp] 168 / 4e-56 ND / Lus10025361 [exp] 178 / 2e-55 AT2G14740 454 / 2e-155 VACUOLAR SORTING RECEPTOR 3, VACUOLAR SORTING RECEPTOR 2;2, binding protein of 80 kDa 2;2, vaculolar sorting receptor 3 (.1.2) Lus10038712 [exp] 166 / 3e-55 ND / Lus10006254 [exp] 169 / 4e-55 ND / Lus10005846 [exp] 164 / 1e-53 ND / Lus10031074 [exp] 164 / 4e-53 ND / Lus10022968 [exp] 176 / 5e-53 AT1G10790 214 / 8e-63 unknown protein Lus10040033 [exp] 160 / 5e-53 ND /
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10010383 pacid=23146085 polypeptide=Lus10010383 locus=Lus10010383.g ID=Lus10010383.BGIv1.0 annot-version=v1.0 ATGGTTCAGACCATTTGTGATAGAGGTGGCCCCGCTGTACAGGCCTTGACTTCACTGGTGCGGTCCCAGTATCAACCAGAATCTGACGGAATGAAAGAGC CGAAGAAGTCGGATGCGCCTAAAGGCCGGCCCCGTGCGCGAAAGACCGATGGGCGGCACCCTTCGTACCACGAGCATGCGAGTGCTCATTGCACCCCATC TAAGGGCAAGGCCAAATCAGGTAGCGGAACTGCGCAAGCGGCTAAACCCACCCTAAGCAAGTCTAGAACCTCTATTCCTAGCAGAGGTGTGTAG
AA sequence Show only first row Show all	>Lus10010383 pacid=23146085 polypeptide=Lus10010383 locus=Lus10010383.g ID=Lus10010383.BGIv1.0 annot-version=v1.0 MVQTICDRGGPAVQALTSLVRSQYQPESDGMKEPKKSDAPKGRPRARKTDGRHPSYHEHASAHCTPSKGKAKSGSGTAQAAKPTLSKSRTSIPSRGV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10010383 [exp]	0	1
AT3G53180		NodGS	nodulin/glutamine synthase-lik...		Lus10023904 [exp]	1.7	1.0000
AT4G11530		CRK34	cysteine-rich RLK (RECEPTOR-li...		Lus10022285 [exp]	2.4	1.0000
					Lus10000380 [exp]	3.0	1.0000
AT2G39080		EMB2799	EMBRYO DEFECTIVE 2799, NAD(P)-...		Lus10037911 [exp]	4.0	0.9994
AT2G24280			alpha/beta-Hydrolases superfam...		Lus10024449 [exp]	4.9	0.9856
					Lus10009632 [exp]	5.0	0.9972
AT4G23180		RLK4, CRK10	cysteine-rich RLK (RECEPTOR-li...		Lus10015092 [exp]	5.3	0.9820
AT3G06060		TSC10A	TSC10A, NAD(P)-binding Rossman...		Lus10039501 [exp]	6.3	0.9672
AT5G18190			Protein kinase family protein ...		Lus10043244 [exp]	6.3	0.9482
AT1G08590			Leucine-rich receptor-like pro...		Lus10002754 [exp]	7.5	0.8539

Compare expression of checked genes

Lus10010383 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.