Lus10010387 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10041676 238 / 7e-80 ND /
Lus10018646 185 / 3e-60 ND /
Lus10041677 174 / 6e-55 ND /
Lus10028987 130 / 4e-38 ND /
Lus10026135 77 / 4e-17 ND /
Lus10008678 56 / 2e-09 ND /
Lus10035524 54 / 4e-09 ND /
Lus10016944 50 / 7e-08 ND /
Lus10039441 45 / 6e-06 ND /
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10010387 pacid=23146077 polypeptide=Lus10010387 locus=Lus10010387.g ID=Lus10010387.BGIv1.0 annot-version=v1.0
ATGGCATCTCCGTTTGTGTTGAACTCCAACAACCAATGGCTGGTTGCAGTTTCCGACCGCACCATCATTGTGACCGATCCAGGGCTGGATCTCAACATTG
ACAACCTCCACAGCACCATAGAGCAGTGGCGGCAGATGGCTCGGGTCAGATCCAATTCCTTATCCACCCACCGCGAATTAGAATTGTTTAGGGTGGTCTT
CTCCGCAAAAAACCTGGTGCAGCTCTCCACCGAAATCATCAACCTCCAGCTGTTCGTTAATCGGAAGGGGTTTATGTATTTCAACATCGGTGCCCCACAC
ATGTACCTGAATCTTAAGGGACACACGAGCCTCGTCCGCCGCCTCAGCAATCTGTTCGATTGGTCAAAGTACGGCGTCAATGTTCCAATTCTCGTGGGCA
TTACATGGAGCCGATCCGAATTGAACACGGGGAATCTGATGGTGAATAGCATAAGGGACGGGAACAAGGTGGAGTAG
AA sequence
>Lus10010387 pacid=23146077 polypeptide=Lus10010387 locus=Lus10010387.g ID=Lus10010387.BGIv1.0 annot-version=v1.0
MASPFVLNSNNQWLVAVSDRTIIVTDPGLDLNIDNLHSTIEQWRQMARVRSNSLSTHRELELFRVVFSAKNLVQLSTEIINLQLFVNRKGFMYFNIGAPH
MYLNLKGHTSLVRRLSNLFDWSKYGVNVPILVGITWSRSELNTGNLMVNSIRDGNKVE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10010387 0 1
AT3G11980 FAR2, MS2 MALE STERILITY 2, FATTY ACID R... Lus10000852 3.9 0.6731
AT1G21200 Trihelix sequence-specific DNA binding ... Lus10042805 11.7 0.6642
AT1G17750 AtPEPR2 PEP1 receptor 2 (.1) Lus10032945 21.2 0.6362
AT5G16890 Exostosin family protein (.1) Lus10013787 27.3 0.6222
AT5G61310 Cytochrome c oxidase subunit V... Lus10001454 32.7 0.6454
AT1G60730 NAD(P)-linked oxidoreductase s... Lus10037408 40.5 0.6026
AT5G24860 ATFPF1, FPF1 ARABIDOPSIS FLOWERING PROMOTIN... Lus10037510 41.3 0.6387
AT4G00620 EMB3127 EMBRYO DEFECTIVE 3127, Amino a... Lus10022670 60.5 0.6064
AT3G02100 UDP-Glycosyltransferase superf... Lus10015752 60.9 0.5747
AT3G52730 ubiquinol-cytochrome C reducta... Lus10017043 61.0 0.6125

Lus10010387 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.