Lus10010392 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G24204 84 / 4e-21 RING/U-box superfamily protein (.1.2.3)
AT2G38185 61 / 4e-11 RING/U-box superfamily protein (.1.2.3.4)
AT2G38195 51 / 9e-08 RING/U-box superfamily protein (.1.2)
AT1G63900 51 / 1e-07 DAL1 DIAP1-like protein 1, E3 Ubiquitin ligase family protein (.1.2)
AT2G38220 50 / 3e-07 RING/U-box superfamily protein (.1)
AT4G14365 49 / 4e-07 XBAT34 XB3 ortholog 4 in Arabidopsis thaliana (.1)
AT5G01450 49 / 4e-07 RING/U-box superfamily protein (.1)
AT3G23280 49 / 7e-07 XBAT35 XB3 ortholog 5 in Arabidopsis thaliana (.1.2)
AT1G54150 48 / 8e-07 E3 Ubiquitin ligase family protein (.1)
AT3G53410 47 / 1e-06 RING/U-box superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10002487 64 / 5e-12 AT5G01450 347 / 5e-115 RING/U-box superfamily protein (.1)
Lus10004813 59 / 2e-10 AT2G38185 309 / 2e-100 RING/U-box superfamily protein (.1.2.3.4)
Lus10000533 54 / 1e-08 AT1G54150 349 / 5e-119 E3 Ubiquitin ligase family protein (.1)
Lus10027994 52 / 6e-08 AT1G63900 532 / 0.0 DIAP1-like protein 1, E3 Ubiquitin ligase family protein (.1.2)
Lus10003551 47 / 1e-06 AT3G23280 115 / 5e-30 XB3 ortholog 5 in Arabidopsis thaliana (.1.2)
Lus10008163 47 / 2e-06 AT1G63900 533 / 0.0 DIAP1-like protein 1, E3 Ubiquitin ligase family protein (.1.2)
Lus10037412 47 / 3e-06 AT3G09770 351 / 6e-120 LOSS OF GDU 2, RING/U-box superfamily protein (.1.2)
Lus10041300 47 / 3e-06 AT3G09770 352 / 3e-120 LOSS OF GDU 2, RING/U-box superfamily protein (.1.2)
Lus10023182 46 / 6e-06 AT3G09770 364 / 5e-126 LOSS OF GDU 2, RING/U-box superfamily protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G050500 101 / 3e-27 AT4G24204 81 / 4e-20 RING/U-box superfamily protein (.1.2.3)
Potri.014G020900 88 / 1e-20 AT5G01450 116 / 9e-29 RING/U-box superfamily protein (.1)
Potri.001G251900 66 / 1e-12 AT5G01450 327 / 7e-108 RING/U-box superfamily protein (.1)
Potri.006G100400 64 / 4e-12 AT2G38185 341 / 2e-113 RING/U-box superfamily protein (.1.2.3.4)
Potri.016G116300 64 / 5e-12 AT5G01450 348 / 3e-116 RING/U-box superfamily protein (.1)
Potri.003G065500 53 / 2e-08 AT1G54150 341 / 3e-115 E3 Ubiquitin ligase family protein (.1)
Potri.014G138000 53 / 2e-08 AT1G63900 548 / 0.0 DIAP1-like protein 1, E3 Ubiquitin ligase family protein (.1.2)
Potri.001G168700 53 / 3e-08 AT1G54150 301 / 1e-99 E3 Ubiquitin ligase family protein (.1)
Potri.006G128700 47 / 2e-06 AT3G09770 380 / 4e-131 LOSS OF GDU 2, RING/U-box superfamily protein (.1.2)
Potri.005G225300 45 / 1e-05 AT3G23280 355 / 2e-118 XB3 ortholog 5 in Arabidopsis thaliana (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0229 RING PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger)
Representative CDS sequence
>Lus10010392 pacid=23146078 polypeptide=Lus10010392 locus=Lus10010392.g ID=Lus10010392.BGIv1.0 annot-version=v1.0
ATGGGCGCCATTTCTGACAGAGGAGGAGGTGAATGGTCTTCCTTGCTTGTTCTTCTTGCCAATCTACTGGCTTACTTCATGGTTTTAGGTTCCCTGCTTC
TCAAACACAACTCTCTTCTCCACAGTTCCAGGCCCTGGTTTGTAATCATAATGATCTTTCTGGTGCTGAAAATCTCGTCTTATTTCGTGAATGTGACGGA
GGAAGAAGCAGCAGGGGAGGATGCAATTGAAATTGATCCATTGCTACTCCAACAGAAAACGGCTGTCTTATATGCTTATTATGGAACTTGTGGTGACCAT
CAAGAGTCCCTGGCGGCTGCAACTTGTAGTAGCAGCAGCAGCAGCTCCTCCTCCAATGGAGTAGCAGCTCATGATGACAATCATGGTTCGGATGATCAAG
TCAAATTGTGCGTGATATGCTACGATGAGGAACGAAATTCATTCTTTGTTCCTTGTGGCCACTCCGCTACTTGTCTTGCTTGTGCTCGAAGGATCTATAA
TGAGGAAAACAAGGTTTGCCCAGTATGTAGAAGATTGATTGGCAGAGTCAAGAAACTCTGA
AA sequence
>Lus10010392 pacid=23146078 polypeptide=Lus10010392 locus=Lus10010392.g ID=Lus10010392.BGIv1.0 annot-version=v1.0
MGAISDRGGGEWSSLLVLLANLLAYFMVLGSLLLKHNSLLHSSRPWFVIIMIFLVLKISSYFVNVTEEEAAGEDAIEIDPLLLQQKTAVLYAYYGTCGDH
QESLAAATCSSSSSSSSSNGVAAHDDNHGSDDQVKLCVICYDEERNSFFVPCGHSATCLACARRIYNEENKVCPVCRRLIGRVKKL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G24204 RING/U-box superfamily protein... Lus10010392 0 1
AT3G10150 ATPAP16, PAP16 purple acid phosphatase 16 (.1... Lus10005170 3.5 0.7094
AT2G01770 ATVIT1, VIT1 vacuolar iron transporter 1 (.... Lus10003704 5.7 0.7490
AT1G02335 GL22 germin-like protein subfamily ... Lus10004857 8.4 0.7469
Lus10006529 31.2 0.6099
AT1G17930 Aminotransferase-like, plant m... Lus10011644 32.4 0.6180
AT5G53910 RING/U-box superfamily protein... Lus10011380 32.4 0.6099
Lus10013260 33.7 0.6099
AT3G13790 ATCWINV1, ATBFR... ARABIDOPSIS THALIANA CELL WALL... Lus10015614 34.9 0.6099
Lus10035557 36.0 0.6099
Lus10005297 37.1 0.6099

Lus10010392 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.