Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008153 [exp] 215 / 1e-73 ND / Lus10014871 [exp] 200 / 6e-68 ND / Lus10008850 [exp] 195 / 4e-65 AT1G48120 39 / 8e-04 hydrolases;protein serine/threonine phosphatases (.1) Lus10017027 [exp] 204 / 1e-64 AT1G57790 286 / 6e-93 F-box family protein (.1) Lus10003026 [exp] 196 / 2e-64 AT2G25010 45 / 4e-05 Aminotransferase-like, plant mobile domain family protein (.1) Lus10016306 [exp] 192 / 2e-63 ND / Lus10004111 [exp] 182 / 2e-60 ND / Lus10015869 [exp] 183 / 3e-60 AT1G48120 44 / 3e-05 hydrolases;protein serine/threonine phosphatases (.1) Lus10006285 [exp] 174 / 2e-57 ND /
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10010397 pacid=23146081 polypeptide=Lus10010397 locus=Lus10010397.g ID=Lus10010397.BGIv1.0 annot-version=v1.0 ATGCCAGAGGTTGCTGTCAGGCCTGCTGATGGCGTATTGTATGATGTGTGCCACTTGAGGTGCAATTTCAGCCATCCCGGTGCTTTGGCATACTTGCCAA AGATTAGCATTCCGTCTGTACCTCGTGCACCTGACGGTAATGTGTTCCCTGATTACCTGGCATGGTATATCGACCGCACACATCCATACATCACGCCGTC AGTCACGGCAGAGGAGCCGCCGGTTTCTAATTATCCGTCACAGCCTCTTTCTGACCGCATTGTACACGGATTGGCGCCCCTTTGGGAAGCTGACACTGTC GAGGCGTTTGTTGACAGAGGAGCAGAGTACTTCGGATTGGTTCAGTCCATGGAGGGTCTGTTTCGAGAGTTTATGCACTAG
AA sequence Show only first row Show all	>Lus10010397 pacid=23146081 polypeptide=Lus10010397 locus=Lus10010397.g ID=Lus10010397.BGIv1.0 annot-version=v1.0 MPEVAVRPADGVLYDVCHLRCNFSHPGALAYLPKISIPSVPRAPDGNVFPDYLAWYIDRTHPYITPSVTAEEPPVSNYPSQPLSDRIVHGLAPLWEADTV EAFVDRGAEYFGLVQSMEGLFREFMH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10010397 [exp]	0	1
AT1G09080		BIP3	binding protein 3, Heat shock ...		Lus10013055 [exp]	1.4	0.9919
AT3G04720		HEL, PR-4, PR4	HEVEIN-LIKE, pathogenesis-rela...		Lus10006244 [exp]	2.0	0.9879
AT5G13240			transcription regulators (.1)		Lus10034638 [exp]	2.8	0.9743
					Lus10020194 [exp]	3.0	0.9874
AT2G37540			NAD(P)-binding Rossmann-fold s...		Lus10023762 [exp]	3.3	0.9565
AT5G18470			Curculin-like (mannose-binding...		Lus10003099 [exp]	5.2	0.9699
					Lus10019564 [exp]	5.5	0.9731
					Lus10002411 [exp]	7.0	0.9714
					Lus10014195 [exp]	7.7	0.9716
AT2G16460			Protein of unknown function (D...		Lus10041812 [exp]	8.5	0.9699

Compare expression of checked genes

Lus10010397 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.