Lus10010406 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G45590 130 / 8e-39 Ribosomal protein L35 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10010409 275 / 4e-96 AT5G45590 147 / 1e-45 Ribosomal protein L35 (.1)
Lus10012140 241 / 2e-82 AT5G45590 148 / 7e-46 Ribosomal protein L35 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G099900 152 / 2e-47 AT5G45590 134 / 2e-40 Ribosomal protein L35 (.1)
Potri.001G133600 144 / 2e-44 AT5G45590 105 / 3e-29 Ribosomal protein L35 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01632 Ribosomal_L35p Ribosomal protein L35
Representative CDS sequence
>Lus10010406 pacid=23154127 polypeptide=Lus10010406 locus=Lus10010406.g ID=Lus10010406.BGIv1.0 annot-version=v1.0
ATGCTGAGATTCTGTACAAAGCTCCGCTCTATAGCGGCACAATCGTCGGCGGCGGCTCAATCTCCGATCTTCCGGGCATCTTCCCGTCTCCTTATTAATC
ATTCTTCCCCGCTAATCCCTTCCAAATTCCGATCTCTCCACTCCGGAGCTGCTTCCACTGCTTGGAGCCTTAGCGGGCAGCTTATCAATGCGCCCAAATT
GCCGTCTGCATTGGCTTCCTCTCCATCGCCCTTCTCTTTGGTGAGTGTCCGCTGTGTTTCATCGAGGGAGCGGAAGAAGAGGAGGAAGCCGATGACCCCA
GTTACCTCCAAAGTGAAGAAGATTAAAATGAAGGGTTACTCTTCATACAAGGGCAGGTTTCGGGCATTGAAAGATGGGACTATTCGTCGTTGGCATGAGG
GTAAGAGACACAATGCGCACTTGAAGTCGAGTAAAGCAAAGCGCAGACTTCGACAGCCTGCTCTCGTCCATCCAGCATATGCCACGGTCATGAAGAAGCT
CAACTTCTTCAACTAA
AA sequence
>Lus10010406 pacid=23154127 polypeptide=Lus10010406 locus=Lus10010406.g ID=Lus10010406.BGIv1.0 annot-version=v1.0
MLRFCTKLRSIAAQSSAAAQSPIFRASSRLLINHSSPLIPSKFRSLHSGAASTAWSLSGQLINAPKLPSALASSPSPFSLVSVRCVSSRERKKRRKPMTP
VTSKVKKIKMKGYSSYKGRFRALKDGTIRRWHEGKRHNAHLKSSKAKRRLRQPALVHPAYATVMKKLNFFN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G45590 Ribosomal protein L35 (.1) Lus10010406 0 1
AT3G45980 H2B, HTB9 HISTONE H2B, Histone superfami... Lus10041347 7.3 0.9327
AT3G55280 RPL23A2, RPL23A... RIBOSOMAL PROTEIN L23A2, ribos... Lus10003290 8.7 0.9015
AT3G57830 Leucine-rich repeat protein ki... Lus10021022 12.0 0.9154
AT5G59690 Histone superfamily protein (.... Lus10014264 14.1 0.9190
AT3G13560 O-Glycosyl hydrolases family 1... Lus10039179 14.3 0.8891
AT3G45980 H2B, HTB9 HISTONE H2B, Histone superfami... Lus10017292 14.8 0.9245
AT3G02400 FHA SMAD/FHA domain-containing pro... Lus10018056 15.5 0.9129
AT5G60030 unknown protein Lus10023334 15.9 0.8636
AT1G15190 Fasciclin-like arabinogalactan... Lus10023183 15.9 0.9087
AT1G68400 leucine-rich repeat transmembr... Lus10035138 17.1 0.9115

Lus10010406 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.