Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G32210 207 / 5e-71 ATDAD1 DEFENDER AGAINST APOPTOTIC DEATH 1, Defender against death (DAD family) protein (.1) AT2G35520 202 / 3e-69 DAD2 DEFENDER AGAINST CELL DEATH 2, Defender against death (DAD family) protein (.1), Defender against death (DAD family) protein (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10012136 [exp] 230 / 6e-80 AT1G32210 208 / 2e-71 DEFENDER AGAINST APOPTOTIC DEATH 1, Defender against death (DAD family) protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G096800 [exp] 211 / 2e-72 AT1G32210 213 / 2e-73 DEFENDER AGAINST APOPTOTIC DEATH 1, Defender against death (DAD family) protein (.1) Potri.001G136800 [exp] 206 / 1e-70 AT2G35520 203 / 3e-69 DEFENDER AGAINST CELL DEATH 2, Defender against death (DAD family) protein (.1), Defender against death (DAD family) protein (.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02109 [flax] [poplar] DAD DAD family
Representative CDS sequence Show only first row Show all	>Lus10010413 pacid=23154088 polypeptide=Lus10010413 locus=Lus10010413.g ID=Lus10010413.BGIv1.0 annot-version=v1.0 ATGGGGCGATCTACAGTGAAGGACACGCAGGCACTCTTCCAGTCCCTTCGATCTGCTTACGCCGCCACTCCTAACAACCTCAAGATCATCGATCTGTACG TCGCTTTCGCTGTCTTCACCGCTGTAATTCAGGTGGTGTACATGGCAGTTGTGGGTTCATTCCCTTTCAATTCGTTCCTCTCCGGAGTGCTCTCTTGCAT TGGGACTGCAGTGCTTGCTGTTTGTCTACGCATCCAAGTGAACAAAGACAACAAGGACTTCAAGGATTTGGCTCCAGAGCGCGCTTTTGCCGATTTCGTT CTATGCAACTTGGTGCTTCACTTGGTGATCATGAACTTCCTAGGCTGA
AA sequence Show only first row Show all	>Lus10010413 pacid=23154088 polypeptide=Lus10010413 locus=Lus10010413.g ID=Lus10010413.BGIv1.0 annot-version=v1.0 MGRSTVKDTQALFQSLRSAYAATPNNLKIIDLYVAFAVFTAVIQVVYMAVVGSFPFNSFLSGVLSCIGTAVLAVCLRIQVNKDNKDFKDLAPERAFADFV LCNLVLHLVIMNFLG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G32210		ATDAD1	DEFENDER AGAINST APOPTOTIC DEA...		Lus10010413 [exp]	0	1
AT1G27695			glycine-rich protein (.1.2)		Lus10032855 [exp]	2.0	0.8601
AT1G29990		PFD6, PDF6	prefoldin 6 (.1)		Lus10023313 [exp]	3.2	0.8517
AT5G61310			Cytochrome c oxidase subunit V...		Lus10002429 [exp]	4.9	0.8250
AT5G12320			ankyrin repeat family protein ...		Lus10036033 [exp]	6.3	0.7997
AT2G43780			unknown protein		Lus10035718 [exp]	10.8	0.7951
AT2G37120			S1FA-like DNA-binding protein ...		Lus10015073 [exp]	12.0	0.7663
AT1G07960		ATPDIL5-1	PDI-like 5-1 (.1.2.3)		Lus10036125 [exp]	12.2	0.8181
AT3G09890			Ankyrin repeat family protein ...		Lus10023911 [exp]	14.3	0.7597
AT2G28430			unknown protein		Lus10022580 [exp]	15.5	0.7791
AT5G09830			BolA-like family protein (.1)		Lus10020861 [exp]	16.4	0.8212

Compare expression of checked genes

Lus10010413 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.