Lus10010418 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10010416 220 / 4e-75 ND 36 / 0.004
Lus10012134 189 / 9e-63 AT5G40380 37 / 0.002 cysteine-rich RLK (RECEPTOR-like protein kinase) 42 (.1)
Lus10012131 174 / 5e-57 ND 36 / 0.005
Lus10010417 169 / 7e-55 ND 37 / 0.002
Lus10012130 167 / 3e-54 ND 39 / 4e-04
Lus10012132 164 / 7e-53 ND 38 / 0.001
Lus10012129 161 / 7e-52 ND /
Lus10012128 158 / 7e-51 ND /
Lus10010415 94 / 3e-25 ND /
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G141400 39 / 0.0007 AT5G40380 390 / 6e-127 cysteine-rich RLK (RECEPTOR-like protein kinase) 42 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01657 Stress-antifung Salt stress response/antifungal
Representative CDS sequence
>Lus10010418 pacid=23154068 polypeptide=Lus10010418 locus=Lus10010418.g ID=Lus10010418.BGIv1.0 annot-version=v1.0
ATGTCGCCTCTGCCGCCGACCCTAATGATTGTAGTGACATCAGCAATGATGATGTTGTCGGCAGTCAACTGTTACGACGACCATTCTGGATACTGTGCTG
GACCTGAATACGTCTGCAGGCACAGCCAAAGCATGCTGCCGGAAGGGCGCACTGATCAACTTAACATAGACTTGACATTTCACGAATACGCCTTCAGCTC
TCCAGCCGTTTGCCGCCGTTTAGAAAATCTGAATAAGGATATGAATTTCAATGTCTACGCTTACTTCTCCTGCAGCCTTGACCATTGCTTCAACTGCTAT
GACGACGCCTTTGGGCACCTGCTGAACACGGACGTGTGCTCCGGCAAGGACGGCGGCTTCATCTCGTTGGATGGCTGCTGTTTAAGGTACGAGAAGTACG
ACTTCTGCGGCGCTCCGAACTGA
AA sequence
>Lus10010418 pacid=23154068 polypeptide=Lus10010418 locus=Lus10010418.g ID=Lus10010418.BGIv1.0 annot-version=v1.0
MSPLPPTLMIVVTSAMMMLSAVNCYDDHSGYCAGPEYVCRHSQSMLPEGRTDQLNIDLTFHEYAFSSPAVCRRLENLNKDMNFNVYAYFSCSLDHCFNCY
DDAFGHLLNTDVCSGKDGGFISLDGCCLRYEKYDFCGAPN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10010418 0 1
AT5G52975 Protein of unknown function (D... Lus10032886 1.0 0.9554
AT5G16460 Putative adipose-regulatory pr... Lus10020213 5.5 0.7032
Lus10008653 5.7 0.6841
AT5G04390 C2H2ZnF C2H2-type zinc finger family p... Lus10040425 6.5 0.8216
AT1G17930 Aminotransferase-like, plant m... Lus10005495 7.3 0.8230
Lus10011594 9.0 0.8230
Lus10008418 9.8 0.7445
Lus10002099 10.4 0.8230
AT4G17920 RING/U-box superfamily protein... Lus10030972 11.6 0.8230
AT2G42850 CYP718 "cytochrome P450, family 718",... Lus10031391 12.7 0.8230

Lus10010418 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.