Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G05080 81 / 1e-20 ATUBC22, UBC22 ubiquitin-conjugating enzyme 22 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10038982 [exp] 97 / 3e-26 AT5G05080 310 / 1e-105 ubiquitin-conjugating enzyme 22 (.1.2) Lus10027282 [exp] 54 / 3e-10 AT5G05080 284 / 1e-95 ubiquitin-conjugating enzyme 22 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G026900 [exp] 93 / 3e-25 AT5G05080 376 / 4e-133 ubiquitin-conjugating enzyme 22 (.1.2) Potri.016G024800 [exp] 91 / 1e-24 AT5G05080 372 / 1e-131 ubiquitin-conjugating enzyme 22 (.1.2) Potri.010G173100 [exp] 65 / 2e-14 AT2G40980 750 / 0.0 Protein kinase superfamily protein (.1) Potri.008G083300 [exp] 53 / 4e-10 AT2G40980 745 / 0.0 Protein kinase superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10010432 pacid=23154063 polypeptide=Lus10010432 locus=Lus10010432.g ID=Lus10010432.BGIv1.0 annot-version=v1.0 ATGGCGACAAACGAAAATCTTCCACCAAATGTAATAAAGCAACTTGCAAGAGAGCTGAAGAGTCTTGATGAATCCCCGCCTGAGGGCATCAAAGTAGGCG TTAAGGACGATGATCTTTCCGTCATATATGCTGAAATTGAAGGGCCAGGCAAGCAACTCTAG
AA sequence Show only first row Show all	>Lus10010432 pacid=23154063 polypeptide=Lus10010432 locus=Lus10010432.g ID=Lus10010432.BGIv1.0 annot-version=v1.0 MATNENLPPNVIKQLARELKSLDESPPEGIKVGVKDDDLSVIYAEIEGPGKQL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G05080		ATUBC22, UBC22	ubiquitin-conjugating enzyme 2...		Lus10010432 [exp]	0	1
AT4G36920	AP2_ERF	FL1, FLO2, AP2	FLORAL MUTANT 2, FLOWER 1, APE...		Lus10009374 [exp]	16.7	0.7825
AT4G09900		ATMES12	ARABIDOPSIS THALIANA METHYL ES...		Lus10003511 [exp]	29.1	0.7908
AT4G08310			unknown protein		Lus10003736 [exp]	32.0	0.7941
AT2G30280		RDM4, DMS4	DEFECTIVE IN MERISTEM SILENCIN...		Lus10035851 [exp]	51.1	0.7816
AT5G19090			Heavy metal transport/detoxifi...		Lus10031514 [exp]	55.1	0.7510
AT3G05760	C2H2ZnF		C2H2 and C2HC zinc fingers sup...		Lus10031406 [exp]	70.7	0.7612
AT5G18540			unknown protein		Lus10033960 [exp]	71.4	0.7556
AT5G49540			Rab5-interacting family protei...		Lus10029365 [exp]	92.2	0.7587
AT5G24610			unknown protein		Lus10000066 [exp]	99.3	0.7170
AT4G10970			unknown protein		Lus10032393 [exp]	110.5	0.7531

Compare expression of checked genes

Lus10010432 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.