Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G04200 92 / 3e-24 AtMCP2f, ATMC9 metacaspase 2f, metacaspase 9 (.1) AT1G79330 70 / 9e-16 ATMC5, AMC6, ATMCP2B metacaspase 2b, metacaspase 5 (.1) AT1G79340 67 / 6e-15 AtMCP2d, ATMC4 metacaspase 2d, metacaspase 4 (.1) AT1G79310 66 / 1e-14 AtMCP2a, ATMC7 metacaspase 2a, metacaspase 7 (.1) AT1G79320 66 / 1e-14 AtMCP2c, ATMC6 metacaspase 2c, metacaspase 6 (.1) AT1G16420 54 / 2e-10 AtMCP2e, ATMC8 metacaspase 2e, ARABIDOPSIS THALIANA METACASPASE 8, metacaspase 8 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10012106 [exp] 136 / 4e-41 AT5G04200 392 / 2e-137 metacaspase 2f, metacaspase 9 (.1) Lus10001761 [exp] 65 / 4e-14 AT1G79340 560 / 0.0 metacaspase 2d, metacaspase 4 (.1) Lus10001835 [exp] 64 / 6e-14 AT1G79340 554 / 0.0 metacaspase 2d, metacaspase 4 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G024500 [exp] 97 / 4e-26 AT5G04200 425 / 1e-150 metacaspase 2f, metacaspase 9 (.1) Potri.006G026500 [exp] 94 / 4e-25 AT5G04200 426 / 4e-151 metacaspase 2f, metacaspase 9 (.1) Potri.008G081100 [exp] 75 / 9e-18 AT1G79330 510 / 0.0 metacaspase 2b, metacaspase 5 (.1) Potri.010G175000 [exp] 74 / 2e-17 AT1G79340 496 / 2e-175 metacaspase 2d, metacaspase 4 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0093 [flax] [poplar] Peptidase_CD PF00656 [flax] [poplar] Peptidase_C14 Caspase domain
Representative CDS sequence Show only first row Show all	>Lus10010436 pacid=23154146 polypeptide=Lus10010436 locus=Lus10010436.g ID=Lus10010436.BGIv1.0 annot-version=v1.0 ATGGCTAGTGGCGGAGGAAAGGCTTACGGAGCGTTCAGTAACGCGATTCAGAAAGTGTTGAAGGAGAATCAGGGTGCCTCGAGCAACAAGGAAGTCGTGG TTAGGGCAAGAGAAGTGTTGAAGGAGCAAGGGTTTGTGAACCAGCATCCTTGCCTTTATTGCAGTGATGAGAATGCTACTGCTGCTTTCCTATGCCAATG A
AA sequence Show only first row Show all	>Lus10010436 pacid=23154146 polypeptide=Lus10010436 locus=Lus10010436.g ID=Lus10010436.BGIv1.0 annot-version=v1.0 MASGGGKAYGAFSNAIQKVLKENQGASSNKEVVVRAREVLKEQGFVNQHPCLYCSDENATAAFLCQ

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G04200		AtMCP2f, ATMC9	metacaspase 2f, metacaspase 9 ...		Lus10010436 [exp]	0	1
AT2G16980			Major facilitator superfamily ...		Lus10004157 [exp]	2.0	0.8880
AT4G33090		ATAPM1, APM1	aminopeptidase M1 (.1)		Lus10025002 [exp]	5.2	0.8794
AT2G14095			unknown protein		Lus10010746 [exp]	11.1	0.8819
AT2G43120			RmlC-like cupins superfamily p...		Lus10019561 [exp]	11.2	0.8416
AT5G18980			ARM repeat superfamily protein...		Lus10001111 [exp]	11.7	0.8412
AT3G14360			alpha/beta-Hydrolases superfam...		Lus10003925 [exp]	12.2	0.8461
AT1G61660	bHLH	bHLH112	basic helix-loop-helix (bHLH) ...		Lus10007613 [exp]	13.4	0.8152
AT4G17830			Peptidase M20/M25/M40 family p...		Lus10030957 [exp]	14.8	0.8464
AT4G28530	NAC	ANAC074	NAC domain containing protein ...		Lus10033905 [exp]	17.9	0.8370
AT3G52500			Eukaryotic aspartyl protease f...		Lus10004204 [exp]	18.4	0.7931

Compare expression of checked genes

Lus10010436 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.