Lus10010446 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G19750 240 / 4e-79 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1)
AT5G43140 92 / 3e-22 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1)
AT2G14860 89 / 6e-21 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1)
AT4G33905 81 / 7e-18 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1)
AT4G14305 68 / 7e-14 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2)
AT2G42770 65 / 2e-12 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1)
AT3G24570 60 / 2e-10 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2)
AT4G04470 57 / 9e-10 PMP22 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1)
AT1G52870 54 / 2e-08 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2)
AT4G03410 50 / 3e-07 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10012098 324 / 3e-112 AT5G19750 259 / 4e-86 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1)
Lus10039003 265 / 1e-89 AT5G19750 241 / 1e-79 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1)
Lus10027297 227 / 5e-68 AT3G22270 694 / 0.0 Topoisomerase II-associated protein PAT1 (.1)
Lus10002118 88 / 2e-20 AT2G14860 292 / 6e-100 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1)
Lus10011424 86 / 2e-19 AT2G14860 288 / 3e-98 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1)
Lus10034922 77 / 1e-16 AT3G24570 330 / 4e-116 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2)
Lus10023648 76 / 2e-16 AT3G24570 330 / 6e-116 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2)
Lus10018700 73 / 1e-14 AT5G43140 253 / 2e-83 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1)
Lus10011798 66 / 5e-13 AT4G14305 262 / 1e-90 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G029700 275 / 9e-93 AT5G19750 257 / 5e-85 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1)
Potri.006G032500 272 / 2e-91 AT5G19750 279 / 8e-94 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1)
Potri.001G296400 86 / 9e-20 AT2G14860 300 / 6e-103 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1)
Potri.009G090600 85 / 2e-19 AT4G33905 299 / 1e-102 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1)
Potri.011G007100 71 / 1e-14 AT4G04470 230 / 1e-77 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1)
Potri.018G081600 67 / 3e-13 AT3G24570 309 / 7e-108 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2)
Potri.004G008700 62 / 1e-11 AT4G04470 209 / 2e-69 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1)
Potri.018G037100 62 / 3e-11 AT3G24570 289 / 6e-100 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2)
Potri.010G032900 59 / 3e-10 AT2G42770 271 / 9e-93 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1)
Potri.001G404600 52 / 1e-07 AT1G52870 438 / 6e-154 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04117 Mpv17_PMP22 Mpv17 / PMP22 family
Representative CDS sequence
>Lus10010446 pacid=23154103 polypeptide=Lus10010446 locus=Lus10010446.g ID=Lus10010446.BGIv1.0 annot-version=v1.0
ATGACGACGGTGATGATGCTGACGGCCTCAGAACCCTGCAATTCTCACCCGCCAAACTTCCTCCCTCGGTGGCGGGATTTCTCCCTCGCAGTCGCGCCGC
CATTTCGTTCCCAATCAGCCGCCTTATCTTCGACGGCTTCTGATGGCGGGTCGGGTGGTGCCGGCGGGATCGGTGGCTCCGGCGATGGGAATTCCGGCGG
CGGCGTCGGTGGCGAATCTGGTGGAGGCTCTGACTGGTCTTTACTTTCATGGTATTTGAGTCTTCTCGCGGAGCATCCTGTTCTCACCAAAGCTGTCACC
TCCGCAGTTCTAACTTTTCTCGGCGACTTAATCTGTCAGCTTGTGATTGATCAAGTTCCATCGCCAGACTTGAAGAGGGCATTCTTGTTTGCATCCCTGG
GACTTGTGCTCGTAGGTCCAACGCTGCATTTCTGGTACTTGTACTTGAGTAAACTGGTCACGGTTCCTGGCGGAAGAGGTGCATTAACACGTCTTATGAT
TGACCAGTTCCTATTCTCTCCCGTGTTTATCGGAGTGTTCTTATCTGCGTTGGTGGCGCTTGAAGGCAGACCATCACAAGTCGTACCAAAGCTCCAACAG
GAGTGGCTTTATTCGGTTGTAGCGAATTGGCAGCTATGGATCCCGTTCCAGTTCCTGAACTTCAGGTTCATGCCGCAACAATTTCAGGTTCTGGGTGCAA
ATGTCATTGCTCTGGTGTGGAATGTCATACTCTCATTCAAAGCACACAGAGAGATCCAGCAAAAATAG
AA sequence
>Lus10010446 pacid=23154103 polypeptide=Lus10010446 locus=Lus10010446.g ID=Lus10010446.BGIv1.0 annot-version=v1.0
MTTVMMLTASEPCNSHPPNFLPRWRDFSLAVAPPFRSQSAALSSTASDGGSGGAGGIGGSGDGNSGGGVGGESGGGSDWSLLSWYLSLLAEHPVLTKAVT
SAVLTFLGDLICQLVIDQVPSPDLKRAFLFASLGLVLVGPTLHFWYLYLSKLVTVPGGRGALTRLMIDQFLFSPVFIGVFLSALVALEGRPSQVVPKLQQ
EWLYSVVANWQLWIPFQFLNFRFMPQQFQVLGANVIALVWNVILSFKAHREIQQK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G19750 Peroxisomal membrane 22 kDa (M... Lus10010446 0 1
AT2G17033 pentatricopeptide (PPR) repeat... Lus10025090 3.2 0.7242
AT2G25830 YebC-related (.1) Lus10038722 27.3 0.6121
AT5G13230 Tetratricopeptide repeat (TPR)... Lus10014956 29.3 0.6234
AT5G48470 unknown protein Lus10038234 29.3 0.6305
AT2G20540 MEF21 mitochondrial editing factor ... Lus10007685 31.4 0.5612
Lus10032893 36.9 0.6347
AT4G34180 Cyclase family protein (.1) Lus10031454 38.8 0.6300
AT1G71460 Pentatricopeptide repeat (PPR-... Lus10006174 44.2 0.5952
AT1G30670 bHLH bHLH052 basic helix-loop-helix (bHLH) ... Lus10038432 46.5 0.5343
AT4G39470 Tetratricopeptide repeat (TPR)... Lus10035707 63.6 0.5848

Lus10010446 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.