Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G41290 59 / 3e-11 SSL2 strictosidine synthase-like 2 (.1) AT3G57010 52 / 6e-09 Calcium-dependent phosphotriesterase superfamily protein (.1) AT3G57030 52 / 9e-09 Calcium-dependent phosphotriesterase superfamily protein (.1) AT1G08470 48 / 2e-07 SSL3 strictosidine synthase-like 3 (.1) AT3G57020 47 / 3e-07 Calcium-dependent phosphotriesterase superfamily protein (.1.2) AT5G22020 45 / 1e-06 Calcium-dependent phosphotriesterase superfamily protein (.1) AT3G59530 43 / 1e-05 LAP3 LESS ADHERENT POLLEN 3, Calcium-dependent phosphotriesterase superfamily protein (.1.2) AT2G41300 42 / 1e-05 SSL1 strictosidine synthase-like 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10012095 [exp] 77 / 9e-18 AT2G41290 291 / 2e-96 strictosidine synthase-like 2 (.1) Lus10019377 [exp] 49 / 1e-07 AT3G59530 609 / 0.0 LESS ADHERENT POLLEN 3, Calcium-dependent phosphotriesterase superfamily protein (.1.2) Lus10008151 [exp] 47 / 3e-07 AT3G59530 613 / 0.0 LESS ADHERENT POLLEN 3, Calcium-dependent phosphotriesterase superfamily protein (.1.2) Lus10008451 [exp] 44 / 4e-06 AT1G08470 600 / 0.0 strictosidine synthase-like 3 (.1) Lus10009646 [exp] 44 / 5e-06 AT1G74020 207 / 7e-63 strictosidine synthase 2 (.1) Lus10013370 [exp] 44 / 6e-06 AT1G08470 520 / 0.0 strictosidine synthase-like 3 (.1) Lus10009014 [exp] 42 / 2e-05 AT1G74020 201 / 8e-59 strictosidine synthase 2 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G037700 [exp] 66 / 6e-14 AT2G41290 402 / 3e-139 strictosidine synthase-like 2 (.1) Potri.016G037800 [exp] 54 / 8e-11 AT2G41290 68 / 8e-15 strictosidine synthase-like 2 (.1) Potri.006G040900 [exp] 57 / 1e-10 AT2G41290 381 / 4e-131 strictosidine synthase-like 2 (.1) Potri.008G109966 [exp] 54 / 2e-09 AT3G57030 318 / 5e-107 Calcium-dependent phosphotriesterase superfamily protein (.1) Potri.T015518 [exp] 54 / 2e-09 AT3G57030 318 / 5e-107 Calcium-dependent phosphotriesterase superfamily protein (.1) Potri.016G037900 [exp] 52 / 4e-09 AT3G57030 523 / 0.0 Calcium-dependent phosphotriesterase superfamily protein (.1) Potri.015G037700 [exp] 48 / 2e-07 AT1G74000 218 / 7e-69 strictosidine synthase 3 (.1) Potri.001G214500 [exp] 44 / 6e-06 AT1G08470 628 / 0.0 strictosidine synthase-like 3 (.1) Potri.007G130700 [exp] 43 / 7e-06 AT3G59530 662 / 0.0 LESS ADHERENT POLLEN 3, Calcium-dependent phosphotriesterase superfamily protein (.1.2) Potri.017G027600 [exp] 42 / 3e-05 AT3G59530 640 / 0.0 LESS ADHERENT POLLEN 3, Calcium-dependent phosphotriesterase superfamily protein (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10010448 pacid=23154155 polypeptide=Lus10010448 locus=Lus10010448.g ID=Lus10010448.BGIv1.0 annot-version=v1.0 ATGCAACCAAAGCTCTGTTCCTCCACGGCTGTTCTACTGGCCGTCGCTATCTTCTCCGTAATCTTAATCTTCGTACCGAATATTAATTACACCCGCCAAA TTAACCACAGAATTGTCGCCGGCGGCGACGATCGTAATACTACTCTTCAGCTCCGGCGGCAGCAGGAGATTCAGTTACTGCCGATTGGCGGAGGAGCAAT CGGGCCGGAGACTTTCGCGTTCGGCGGTGACGGAGGTCCGTTCACCGGAGTTTCTGACGGGCGGGTGCTCAGGTGGGTCGGAGCTGAACGGCGGTGGAAT GACTTTGCCGTTACTTCTCCGACGAGGTAA
AA sequence Show only first row Show all	>Lus10010448 pacid=23154155 polypeptide=Lus10010448 locus=Lus10010448.g ID=Lus10010448.BGIv1.0 annot-version=v1.0 MQPKLCSSTAVLLAVAIFSVILIFVPNINYTRQINHRIVAGGDDRNTTLQLRRQQEIQLLPIGGGAIGPETFAFGGDGGPFTGVSDGRVLRWVGAERRWN DFAVTSPTR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G41290		SSL2	strictosidine synthase-like 2 ...		Lus10010448 [exp]	0	1
					Lus10042018 [exp]	3.7	0.7247
AT4G36470			S-adenosyl-L-methionine-depend...		Lus10041380 [exp]	5.3	0.7326
AT1G60190		AtPUB19	plant U-box 19, ARM repeat sup...		Lus10029163 [exp]	6.3	0.7306
AT5G67150			HXXXD-type acyl-transferase fa...		Lus10041591 [exp]	10.1	0.7577
AT3G22970			Protein of unknown function (D...		Lus10014718 [exp]	10.4	0.7666
AT1G60190		AtPUB19	plant U-box 19, ARM repeat sup...		Lus10013001 [exp]	11.1	0.7747
AT1G11340			S-locus lectin protein kinase ...		Lus10013247 [exp]	13.0	0.6980
AT1G13810			Restriction endonuclease, type...		Lus10012108 [exp]	26.9	0.7292
AT3G50120			Plant protein of unknown funct...		Lus10019324 [exp]	33.1	0.7237
AT5G46760	bHLH	bHLH005, ATR2, ...	Basic helix-loop-helix (bHLH) ...		Lus10035365 [exp]	34.2	0.7149

Compare expression of checked genes

Lus10010448 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.