Lus10010459 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G22260 336 / 4e-118 Cysteine proteinases superfamily protein (.1.2.3)
AT3G02070 280 / 2e-96 Cysteine proteinases superfamily protein (.1)
AT5G04250 222 / 1e-71 Cysteine proteinases superfamily protein (.1.2)
AT5G03330 211 / 2e-67 Cysteine proteinases superfamily protein (.1.2)
AT2G39320 92 / 6e-23 Cysteine proteinases superfamily protein (.1)
AT5G67170 69 / 1e-13 SEC-C motif-containing protein / OTU-like cysteine protease family protein (.1.2)
AT2G27350 57 / 2e-09 OTLD1 otubain-like deubiquitinase 1, OTU-like cysteine protease family protein (.1.2.3.4.5.6)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10003816 378 / 6e-135 AT3G22260 298 / 2e-103 Cysteine proteinases superfamily protein (.1.2.3)
Lus10027312 350 / 4e-123 AT3G22260 303 / 3e-104 Cysteine proteinases superfamily protein (.1.2.3)
Lus10038708 216 / 4e-69 AT5G04250 367 / 2e-126 Cysteine proteinases superfamily protein (.1.2)
Lus10026525 214 / 9e-69 AT5G03330 292 / 4e-97 Cysteine proteinases superfamily protein (.1.2)
Lus10037977 210 / 9e-67 AT5G04250 361 / 5e-124 Cysteine proteinases superfamily protein (.1.2)
Lus10013813 202 / 5e-64 AT5G03330 280 / 2e-92 Cysteine proteinases superfamily protein (.1.2)
Lus10001404 202 / 6e-64 AT5G03330 327 / 9e-111 Cysteine proteinases superfamily protein (.1.2)
Lus10023019 202 / 6e-64 AT5G03330 325 / 4e-110 Cysteine proteinases superfamily protein (.1.2)
Lus10037388 189 / 3e-59 AT5G04250 239 / 6e-77 Cysteine proteinases superfamily protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G021700 360 / 6e-128 AT3G22260 347 / 2e-122 Cysteine proteinases superfamily protein (.1.2.3)
Potri.016G019700 347 / 8e-123 AT3G22260 333 / 5e-117 Cysteine proteinases superfamily protein (.1.2.3)
Potri.014G140200 288 / 1e-99 AT3G02070 358 / 2e-127 Cysteine proteinases superfamily protein (.1)
Potri.016G094700 223 / 3e-72 AT5G03330 316 / 9e-107 Cysteine proteinases superfamily protein (.1.2)
Potri.006G125900 223 / 5e-72 AT5G03330 329 / 1e-111 Cysteine proteinases superfamily protein (.1.2)
Potri.010G225400 212 / 2e-67 AT5G04250 360 / 2e-123 Cysteine proteinases superfamily protein (.1.2)
Potri.008G036700 207 / 8e-66 AT5G04250 372 / 2e-128 Cysteine proteinases superfamily protein (.1.2)
Potri.008G036900 189 / 7e-61 AT5G04250 239 / 4e-79 Cysteine proteinases superfamily protein (.1.2)
Potri.005G140500 74 / 4e-15 AT5G67170 401 / 3e-139 SEC-C motif-containing protein / OTU-like cysteine protease family protein (.1.2)
Potri.004G196800 60 / 2e-10 AT2G27350 458 / 3e-157 otubain-like deubiquitinase 1, OTU-like cysteine protease family protein (.1.2.3.4.5.6)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0125 Peptidase_CA PF02338 OTU OTU-like cysteine protease
Representative CDS sequence
>Lus10010459 pacid=23154118 polypeptide=Lus10010459 locus=Lus10010459.g ID=Lus10010459.BGIv1.0 annot-version=v1.0
ATGACCGAAAGCCACAGCAACGCGAGTGCGAGCTCGACCTCTAGCTTTAGTAGCAGCATTGCCGATACAGAGGATGATCAGGTCATTGCAAGCATCTTAG
CTGAAGAAGAAAAGGCTAACGGTGGTAGACAGCTTGGAAAGAGGCTCTCTCATCTGGATTCTATACCTCACACTCTTCGGGTTAATGGTGAGATTCCAGA
TTTGAACGATGCAACCTTAGACCACGTACGGCTTTCTGAAAGGTTGAAGACTTATGGATTAGCGGAACTGCATATGGAGGGCGATGGGAACTGTCAGTTT
CGAGCACTGGCAGACCAGTTGTTCAGAAGTCCAGATTATCACAAACATGTCAGGAAGCAAGTGGTGAAGCAGCTAAAGCAATTCAGAAAGTTTTACGAAA
GCCATGTCCCAATGAAGTACAAAAGCTACATTAGAAAGATGAAAAAATCAGGAGAGTGGGGCGATCACGTGACGCTACAAGCTGCTGCAGATCGATTTGA
AGCCAAGATTTGCTTAGTTACATCTTTCCGCGACACTTGCTACATCGAGATCCGGCCCAAGGACAAGCCTCCCGGGAGAGAGATCTGGCTGAGCTTTTGG
AGCGAAGTTCACTATAACTCGCTATATGCAATTGGAGATGTTCCCACCAGAGTGCCAAGGAAAAGGCATTGGCTCTTCTGA
AA sequence
>Lus10010459 pacid=23154118 polypeptide=Lus10010459 locus=Lus10010459.g ID=Lus10010459.BGIv1.0 annot-version=v1.0
MTESHSNASASSTSSFSSSIADTEDDQVIASILAEEEKANGGRQLGKRLSHLDSIPHTLRVNGEIPDLNDATLDHVRLSERLKTYGLAELHMEGDGNCQF
RALADQLFRSPDYHKHVRKQVVKQLKQFRKFYESHVPMKYKSYIRKMKKSGEWGDHVTLQAAADRFEAKICLVTSFRDTCYIEIRPKDKPPGREIWLSFW
SEVHYNSLYAIGDVPTRVPRKRHWLF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G22260 Cysteine proteinases superfami... Lus10010459 0 1
AT4G33430 SERK3, RKS10, E... RECEPTOR KINASES LIKE SERK 10,... Lus10020962 6.5 0.9050
AT2G32970 unknown protein Lus10035309 7.2 0.8966
AT5G51070 SAG15, CLPD, ER... SENESCENCE ASSOCIATED GENE 15,... Lus10043013 7.6 0.8983
AT1G60995 unknown protein Lus10033791 8.7 0.8902
AT3G15355 UBC25 ,PFU1 PHO2 FAMILY UBIQUITIN CONJUGAT... Lus10018596 9.2 0.8901
AT1G56560 A/N-InvA alkaline/neutral invertase A, ... Lus10031431 11.8 0.8628
AT4G37440 unknown protein Lus10001409 15.0 0.8848
AT4G16144 AMSH3 associated molecule with the S... Lus10036454 16.4 0.8725
AT1G22620 ATSAC1 suppressor of actin 1, Phospho... Lus10014827 16.6 0.8975
AT1G69450 Early-responsive to dehydratio... Lus10037139 25.7 0.8536

Lus10010459 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.