Lus10010461 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G15000 198 / 1e-66 Ribosomal L27e protein family (.1.2)
AT3G22230 198 / 1e-66 Ribosomal L27e protein family (.1)
AT2G32220 186 / 7e-62 Ribosomal L27e protein family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10003814 224 / 5e-77 AT4G15000 239 / 7e-83 Ribosomal L27e protein family (.1.2)
Lus10039017 206 / 1e-69 AT4G15000 232 / 3e-80 Ribosomal L27e protein family (.1.2)
Lus10027314 201 / 1e-67 AT4G15000 233 / 2e-80 Ribosomal L27e protein family (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G021500 203 / 9e-69 AT4G15000 205 / 2e-69 Ribosomal L27e protein family (.1.2)
Potri.016G019000 199 / 3e-67 AT4G15000 209 / 5e-71 Ribosomal L27e protein family (.1.2)
Potri.001G342500 196 / 4e-66 AT4G15000 210 / 2e-71 Ribosomal L27e protein family (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01777 Ribosomal_L27e Ribosomal L27e protein family
CL0107 KOW PF00467 KOW KOW motif
Representative CDS sequence
>Lus10010461 pacid=23154097 polypeptide=Lus10010461 locus=Lus10010461.g ID=Lus10010461.BGIv1.0 annot-version=v1.0
ATGGTGAAGTTCATGAAGCCGAGCAAGGCCGTGATCGTGCTCCAGGGCCGATACGCCGGGCGCAAGGCCGTCATTGTTAAGAACTTCGATGACGGTACCA
AGGACCGCGGCTACGGCCACTGCCTGGTCGCCGGAATCAAGAAGTACCCCGGCAAGGTCATCAGGAAGGATTCGGCCAAGAAGACTGCTAAGAAGTCCCG
CGTCAAGTGCTTCGTCAAGCTCGTCAACTACAGGCATCTGATGCCGACTCGCTACACGCTGGACGTCGACTTGAAGGATGTCGTTACTCCCGATGTGTTG
CAGAGCAAGGAGAAGAAGGTCGCCGCTTCCAAGGAGGCCAAGGCGAAGTTTGAGGAGAGGTTCAAGACTGGGAAGAACAGGTGGTTCTTTACCAAGCTCA
GGTTTTAA
AA sequence
>Lus10010461 pacid=23154097 polypeptide=Lus10010461 locus=Lus10010461.g ID=Lus10010461.BGIv1.0 annot-version=v1.0
MVKFMKPSKAVIVLQGRYAGRKAVIVKNFDDGTKDRGYGHCLVAGIKKYPGKVIRKDSAKKTAKKSRVKCFVKLVNYRHLMPTRYTLDVDLKDVVTPDVL
QSKEKKVAASKEAKAKFEERFKTGKNRWFFTKLRF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G15000 Ribosomal L27e protein family ... Lus10010461 0 1
AT5G48760 Ribosomal protein L13 family p... Lus10022793 1.4 0.9159
AT2G32060 Ribosomal protein L7Ae/L30e/S1... Lus10023825 1.7 0.8973
AT2G31610 Ribosomal protein S3 family pr... Lus10033442 2.8 0.8962
AT5G60670 Ribosomal protein L11 family p... Lus10023186 3.5 0.9037
AT4G25740 RNA binding Plectin/S10 domain... Lus10039282 4.6 0.8803
AT5G02960 Ribosomal protein S12/S23 fami... Lus10026479 4.9 0.8893
AT4G15000 Ribosomal L27e protein family ... Lus10027314 5.0 0.8907
AT3G02080 Ribosomal protein S19e family ... Lus10030702 7.5 0.8742
AT5G39850 Ribosomal protein S4 (.1) Lus10042193 7.7 0.8638
AT3G62870 Ribosomal protein L7Ae/L30e/S1... Lus10009322 8.9 0.8510

Lus10010461 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.