Lus10010466 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10010466 pacid=23154144 polypeptide=Lus10010466 locus=Lus10010466.g ID=Lus10010466.BGIv1.0 annot-version=v1.0
ATGGAAAATTTTCAGAAACTGTGGGAGAACACCCAGTTTCGGGACCCCGATCCCGAGCATGTGGTAGATCCGTCAGTAGCGCAAAATGCTATAAACAGTT
TATGCAGTTCGGTAAAGATACAGATCTCTTTCGATGAGAAAATTCGTCTGGGTCTCACCATGGTGCAAGCAGCTGTGAGAGATGTACACCCTGCTGCCGA
CCGTTCTTCTCTGCAAGCAGACCCTTGGTCTGCCGTCCATTATCTTGCCAACCGATTCAGAATGGCCGTGTCCTTGTATAACATCCAGCTGCGTAAAATG
GCTGCTGAATTGACTCTGCATACTGCTGCACTGAAAAGATGTATTCAAAGATACTCGTCGGACCTCGTTAACCACCCCTCCACCTGGAAGCCTAGGATAG
CCAGAAATATTGTCCTGCTGCCCCTACCGGCGACCAAGGTTGAGGAGATGTCGGACGCTCCAGACGTGGTTGCGTAA
AA sequence
>Lus10010466 pacid=23154144 polypeptide=Lus10010466 locus=Lus10010466.g ID=Lus10010466.BGIv1.0 annot-version=v1.0
MENFQKLWENTQFRDPDPEHVVDPSVAQNAINSLCSSVKIQISFDEKIRLGLTMVQAAVRDVHPAADRSSLQADPWSAVHYLANRFRMAVSLYNIQLRKM
AAELTLHTAALKRCIQRYSSDLVNHPSTWKPRIARNIVLLPLPATKVEEMSDAPDVVA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10010466 0 1
AT1G20550 O-fucosyltransferase family pr... Lus10023948 23.4 0.6303
AT3G06030 AtANP3, MAPKKK1... NPK1-related protein kinase 3 ... Lus10031963 34.0 0.5561
AT1G58060 RNA helicase family protein (.... Lus10012694 65.7 0.5342
AT1G78610 MSL6 mechanosensitive channel of sm... Lus10023990 78.6 0.5245
AT3G19340 Protein of unknown function (D... Lus10041510 143.0 0.5030
AT3G19340 Protein of unknown function (D... Lus10012584 205.0 0.4949
AT3G10910 RING/U-box superfamily protein... Lus10033425 252.6 0.4835

Lus10010466 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.