Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G05675 129 / 2e-36 UDP-Glycosyltransferase superfamily protein (.1) AT2G43840 127 / 5e-36 UGT74F1 UDP-glycosyltransferase 74 F1 (.1.2) AT2G31790 127 / 5e-36 UDP-Glycosyltransferase superfamily protein (.1) AT1G05680 127 / 8e-36 UGT74E2 Uridine diphosphate glycosyltransferase 74E2 (.1) AT2G43820 125 / 2e-35 SGT1, ATSAGT1, GT, UGT74F2 UDP-glucose:salicylic acid glucosyltransferase 1, Arabidopsis thaliana salicylic acid glucosyltransferase 1, UDP-glucosyltransferase 74F2 (.1) AT2G31750 120 / 3e-33 UGT74D1 UDP-glucosyl transferase 74D1 (.1) AT1G24100 117 / 6e-32 UGT74B1 UDP-glucosyl transferase 74B1 (.1) AT3G21560 94 / 2e-23 UGT84A2 UDP-Glycosyltransferase superfamily protein (.1) AT4G14090 93 / 3e-23 UDP-Glycosyltransferase superfamily protein (.1) AT1G05560 92 / 7e-23 UGT75B1, UGT1 UDP-GLUCOSE TRANSFERASE 1, UDP-glucosyltransferase 75B1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10003809 [exp] 181 / 3e-56 AT1G05675 337 / 1e-111 UDP-Glycosyltransferase superfamily protein (.1) Lus10010468 [exp] 178 / 4e-55 AT1G05675 368 / 7e-124 UDP-Glycosyltransferase superfamily protein (.1) Lus10039041 [exp] 161 / 1e-48 AT1G05675 343 / 3e-114 UDP-Glycosyltransferase superfamily protein (.1) Lus10006351 [exp] 129 / 2e-37 AT1G05680 315 / 9e-106 Uridine diphosphate glycosyltransferase 74E2 (.1) Lus10006721 [exp] 127 / 8e-36 AT2G43820 392 / 9e-134 UDP-glucose:salicylic acid glucosyltransferase 1, Arabidopsis thaliana salicylic acid glucosyltransferase 1, UDP-glucosyltransferase 74F2 (.1) Lus10024117 [exp] 125 / 1e-34 AT1G05675 385 / 4e-130 UDP-Glycosyltransferase superfamily protein (.1) Lus10024118 [exp] 125 / 1e-34 AT1G05675 375 / 2e-126 UDP-Glycosyltransferase superfamily protein (.1) Lus10006352 [exp] 124 / 1e-34 AT2G43820 414 / 6e-142 UDP-glucose:salicylic acid glucosyltransferase 1, Arabidopsis thaliana salicylic acid glucosyltransferase 1, UDP-glucosyltransferase 74F2 (.1) Lus10010712 [exp] 124 / 2e-34 AT1G24100 462 / 1e-160 UDP-glucosyl transferase 74B1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G141700 [exp] 125 / 2e-37 AT1G05680 237 / 4e-77 Uridine diphosphate glycosyltransferase 74E2 (.1) Potri.004G179300 [exp] 130 / 9e-37 AT1G05680 446 / 1e-154 Uridine diphosphate glycosyltransferase 74E2 (.1) Potri.017G032500 [exp] 129 / 2e-36 AT1G05680 446 / 1e-154 Uridine diphosphate glycosyltransferase 74E2 (.1) Potri.017G032300 [exp] 128 / 3e-36 AT1G05675 465 / 6e-162 UDP-Glycosyltransferase superfamily protein (.1) Potri.007G140300 [exp] 125 / 3e-35 AT1G05680 457 / 4e-159 Uridine diphosphate glycosyltransferase 74E2 (.1) Potri.017G032733 [exp] 125 / 4e-35 AT1G05680 444 / 6e-154 Uridine diphosphate glycosyltransferase 74E2 (.1) Potri.017G032700 [exp] 125 / 4e-35 AT1G05680 444 / 6e-154 Uridine diphosphate glycosyltransferase 74E2 (.1) Potri.015G071900 [exp] 120 / 3e-33 AT1G24100 427 / 5e-147 UDP-glucosyl transferase 74B1 (.1) Potri.014G175000 [exp] 120 / 5e-33 AT2G43840 411 / 8e-141 UDP-glycosyltransferase 74 F1 (.1.2) Potri.007G117200 [exp] 119 / 1e-32 AT2G43840 461 / 1e-160 UDP-glycosyltransferase 74 F1 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0113 [flax] [poplar] GT-B PF00201 [flax] [poplar] UDPGT UDP-glucoronosyl and UDP-glucosyl transferase
Representative CDS sequence Show only first row Show all	>Lus10010467 pacid=23154075 polypeptide=Lus10010467 locus=Lus10010467.g ID=Lus10010467.BGIv1.0 annot-version=v1.0 ATGTCGTTTATATGGGTAGTTCGAGAATCTGAACAAGACAAGCTACCACGTGGTTTCATCTCCGATGACACGTTATGCCTTGTCGTGGAGTGGTGTCGCC AGCCGGAGGTCCCGTCTCACCCTTTTTTTGGATGCTTCGTAACTCACTGCGGGTGGAACTCGACAATGGAGGCGGTTAGCTTAGGAGTGCCGGTGGTGAA ATTGTCCATTTGGGTGGACCAACCGACCAATGCAAAGTTTGTGGAGGATGTTTGGCACGTGCGGGTACGCGCGAAGGCTGACGTGGCAAAGGAAATCGGA CGACGAATCAAGGAAGTGATGGAAGGAGAGAATGGGAAGAGATTAGAAGGAATGAGGAGAAGTGGAAGAAATTGA
AA sequence Show only first row Show all	>Lus10010467 pacid=23154075 polypeptide=Lus10010467 locus=Lus10010467.g ID=Lus10010467.BGIv1.0 annot-version=v1.0 MSFIWVVRESEQDKLPRGFISDDTLCLVVEWCRQPEVPSHPFFGCFVTHCGWNSTMEAVSLGVPVVKLSIWVDQPTNAKFVEDVWHVRVRAKADVAKEIG RRIKEVMEGENGKRLEGMRRSGRN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G05675			UDP-Glycosyltransferase superf...		Lus10010467 [exp]	0	1
AT1G31280		AGO2	argonaute 2, Argonaute family ...		Lus10040619 [exp]	6.6	0.5772
AT3G04620		DAN1	D NUCLDUO1-ACTIVATEEIC ACID BI...		Lus10006564 [exp]	9.2	0.6261
AT3G26720			Glycosyl hydrolase family 38 p...		Lus10014259 [exp]	9.4	0.6309
AT3G26040			HXXXD-type acyl-transferase fa...		Lus10021391 [exp]	14.6	0.6361
AT5G19790	AP2_ERF	RAP2.11	related to AP2 11 (.1)		Lus10013764 [exp]	16.2	0.4778
AT1G47960		ATC/VIF1, C/VIF...	cell wall / vacuolar inhibitor...		Lus10027947 [exp]	16.7	0.5702
AT1G63820			CCT motif family protein (.1)		Lus10032288 [exp]	19.0	0.5187
AT5G03620			Subtilisin-like serine endopep...		Lus10003254 [exp]	22.1	0.5461
AT2G31083		AtCLE5, CLE5, C...	CLAVATA3/ESR-RELATED 5 (.1)		Lus10002196 [exp]	25.2	0.5335
					Lus10028652 [exp]	27.7	0.5225

Compare expression of checked genes

Lus10010467 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.