Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G07260 70 / 2e-15 UGT71C3 UDP-glucosyl transferase 71C3 (.1) AT1G07240 67 / 2e-14 UGT71C5 UDP-glucosyl transferase 71C5 (.1) AT1G07250 67 / 3e-14 UGT71C4 UDP-glucosyl transferase 71C4 (.1) AT2G29740 66 / 7e-14 UGT71C2 UDP-glucosyl transferase 71C2 (.1) AT2G29750 63 / 7e-13 UGT71C1 UDP-glucosyl transferase 71C1 (.1) AT2G29710 62 / 9e-13 UDP-Glycosyltransferase superfamily protein (.1) AT2G29730 58 / 3e-11 UGT71D1 UDP-glucosyl transferase 71D1 (.1) AT3G21760 55 / 4e-10 HYR1 HYPOSTATIN RESISTANCE 1, UDP-Glycosyltransferase superfamily protein (.1) AT3G21800 55 / 5e-10 UGT71B8 UDP-glucosyl transferase 71B8 (.1) AT3G21790 52 / 3e-09 UDP-Glycosyltransferase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10010476 [exp] 154 / 5e-46 AT1G07250 342 / 7e-113 UDP-glucosyl transferase 71C4 (.1) Lus10003805 [exp] 153 / 9e-46 AT1G07250 332 / 5e-109 UDP-glucosyl transferase 71C4 (.1) Lus10039037 [exp] 76 / 3e-17 AT1G07250 378 / 8e-127 UDP-glucosyl transferase 71C4 (.1) Lus10027334 [exp] 65 / 5e-14 AT1G07260 240 / 2e-77 UDP-glucosyl transferase 71C3 (.1) Lus10026795 [exp] 57 / 9e-11 AT3G21750 448 / 5e-155 UDP-glucosyl transferase 71B1 (.1) Lus10036087 [exp] 57 / 1e-10 AT3G21790 455 / 3e-157 UDP-Glycosyltransferase superfamily protein (.1) Lus10036086 [exp] 53 / 3e-09 AT3G21760 431 / 2e-147 HYPOSTATIN RESISTANCE 1, UDP-Glycosyltransferase superfamily protein (.1) Lus10036088 [exp] 44 / 3e-06 AT3G21760 377 / 3e-126 HYPOSTATIN RESISTANCE 1, UDP-Glycosyltransferase superfamily protein (.1) Lus10006353 [exp] 38 / 0.0005 AT2G43820 398 / 1e-135 UDP-glucose:salicylic acid glucosyltransferase 1, Arabidopsis thaliana salicylic acid glucosyltransferase 1, UDP-glucosyltransferase 74F2 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G044600 [exp] 72 / 3e-16 AT2G29730 488 / 2e-170 UDP-glucosyl transferase 71D1 (.1) Potri.016G015700 [exp] 72 / 3e-16 AT3G21760 354 / 6e-118 HYPOSTATIN RESISTANCE 1, UDP-Glycosyltransferase superfamily protein (.1) Potri.016G016100 [exp] 70 / 3e-15 AT3G21790 431 / 1e-147 UDP-Glycosyltransferase superfamily protein (.1) Potri.016G016300 [exp] 70 / 3e-15 AT3G21790 425 / 4e-145 UDP-Glycosyltransferase superfamily protein (.1) Potri.016G016800 [exp] 69 / 4e-15 AT3G21780 412 / 5e-140 UDP-glucosyl transferase 71B6 (.1) Potri.006G007300 [exp] 68 / 8e-15 AT3G21790 427 / 4e-146 UDP-Glycosyltransferase superfamily protein (.1) Potri.016G016200 [exp] 68 / 8e-15 AT3G21750 396 / 9e-135 UDP-glucosyl transferase 71B1 (.1) Potri.006G007350 [exp] 67 / 2e-14 AT3G21790 427 / 5e-146 UDP-Glycosyltransferase superfamily protein (.1) Potri.016G016400 [exp] 67 / 3e-14 AT3G21790 395 / 2e-133 UDP-Glycosyltransferase superfamily protein (.1) Potri.016G014500 [exp] 66 / 6e-14 AT1G07250 394 / 3e-133 UDP-glucosyl transferase 71C4 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10010474 pacid=23154157 polypeptide=Lus10010474 locus=Lus10010474.g ID=Lus10010474.BGIv1.0 annot-version=v1.0 ATGCATGCAAAGCAGCAGATAAACACATTTTACATTGCGAGAGAGTTAGGGATAGTGATCGAGCTGACGGCAGATTACCCAATATGGGAAAGCGACGGGG ATGGAGAGATCTTGGTGAAAGGAGATGAAATTGCTAGGAAGATTGAGATGGTGATGGACAAGCATAATAAGGTTAGAAAGAAGGTGAAGGAGATGAGTGA GCTCGGAAGGAGAGCTTTGAATGAATGTGGATCTTCATTTGATGCCATTGATGTGTACGATGATTTGGTCTTGAAGAATAAGCCTATGGTTTAG
AA sequence Show only first row Show all	>Lus10010474 pacid=23154157 polypeptide=Lus10010474 locus=Lus10010474.g ID=Lus10010474.BGIv1.0 annot-version=v1.0 MHAKQQINTFYIARELGIVIELTADYPIWESDGDGEILVKGDEIARKIEMVMDKHNKVRKKVKEMSELGRRALNECGSSFDAIDVYDDLVLKNKPMV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G07260		UGT71C3	UDP-glucosyl transferase 71C3 ...		Lus10010474 [exp]	0	1
AT3G54420		ATCHITIV, CHIV,...	CHITINASE CLASS IV, homolog of...		Lus10010863 [exp]	1.7	0.8032
AT4G17905		ATL4H	RING/U-box superfamily protein...		Lus10025338 [exp]	3.5	0.7727
AT2G45120	C2H2ZnF		C2H2-like zinc finger protein ...		Lus10009278 [exp]	8.0	0.7450
AT1G04110		SDD1	STOMATAL DENSITY AND DISTRIBUT...		Lus10029577 [exp]	9.9	0.6500
AT5G39190		ATGER2, GLP2A	GERMIN-LIKE PROTEIN 2A, A. THA...		Lus10033764 [exp]	10.0	0.6578
					Lus10033891 [exp]	13.3	0.6344
AT2G16910	bHLH	AMS, bHLH021	ABORTED MICROSPORES, basic hel...		Lus10042395 [exp]	14.7	0.6785
AT1G17810		BETA-TIP	beta-tonoplast intrinsic prote...		Lus10040652 [exp]	15.2	0.7547
AT3G20800			Cell differentiation, Rcd1-lik...		Lus10015136 [exp]	17.2	0.7057
AT2G43590			Chitinase family protein (.1)		Lus10035618 [exp]	18.3	0.6386

Compare expression of checked genes

Lus10010474 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.