Lus10010479 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G22142 94 / 2e-21 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
AT4G15160 83 / 4e-19 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
AT3G22120 82 / 4e-18 CWLP cell wall-plasma membrane linker protein (.1)
AT1G62500 80 / 2e-17 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
AT2G10940 75 / 9e-16 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
AT4G12470 58 / 2e-10 AZI1 azelaic acid induced 1 (.1)
AT4G12480 56 / 2e-09 PEARLI 1 1, PEARLI 1, pEARLI1 EARLY ARABIDOPSIS ALUMINUM INDUCED 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
AT4G12500 55 / 3e-09 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
AT4G12490 54 / 7e-09 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
AT2G45180 52 / 1e-08 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10003801 114 / 3e-30 AT3G22142 168 / 7e-47 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Lus10010482 107 / 7e-30 AT3G22142 162 / 5e-48 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Lus10010480 81 / 2e-18 ND 127 / 3e-34
Lus10003802 80 / 2e-17 ND 127 / 5e-33
Lus10032262 79 / 3e-17 AT1G62500 162 / 3e-48 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Lus10028930 77 / 1e-16 AT1G62500 141 / 4e-41 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Lus10004349 68 / 3e-13 AT1G62500 134 / 5e-38 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Lus10027704 65 / 1e-12 AT2G10940 135 / 2e-39 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
Lus10001493 60 / 2e-11 AT1G62510 111 / 2e-32 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G008300 98 / 1e-24 AT3G22142 113 / 2e-28 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Potri.006G008500 96 / 2e-24 AT3G22120 80 / 6e-18 cell wall-plasma membrane linker protein (.1)
Potri.016G015500 91 / 8e-21 AT3G22142 161 / 1e-42 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Potri.006G065500 76 / 2e-16 AT2G10940 147 / 8e-44 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
Potri.003G111300 73 / 4e-15 AT1G62500 125 / 2e-34 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Potri.018G126000 74 / 6e-15 AT2G10940 109 / 2e-27 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
Potri.018G025900 56 / 9e-10 AT2G45180 127 / 8e-39 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Potri.008G135860 55 / 7e-09 AT1G62500 75 / 7e-16 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Potri.001G121900 53 / 1e-08 AT1G62510 99 / 5e-27 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Potri.001G158400 52 / 2e-08 AT1G62510 132 / 1e-40 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10010479 pacid=23154137 polypeptide=Lus10010479 locus=Lus10010479.g ID=Lus10010479.BGIv1.0 annot-version=v1.0
ATGGCCAAGCAATACTACTCTCTAGCTAGCTTCTTGCTATTCTTGGTTCTCAACTTGGGAGCCTTGATTGTTCCTTCTCTTGCTTGCCCTTCATGTACTC
TTCCTCCTCCTCCTTGCCCACCAACTAAGCCACCCACCGTCAAGCCGCCTCATGTCCCCAAGCCACCACATGTCAAGCCTCCTCATGTTCCCAAGCCACC
GGTTAAGCCACCACATGTCAAGCCGCCTGTCAAGCCAACACCACCCACTGTCAAGCCAACACCACCTGTCAAGCCAACACCACCTACTGTCAAGCCAACG
CCACCCGTGAAGCCAACACCACCAACTGTCAAGCCAACACCACCCGTGAAGCCAACACCCCCAACTGTCAAGCCAACCCCACCGACTGTCAAGCCTACCC
CACCAACTGTCAAGCCAACACCACCCACAGTCAAGCCAACGCCACCAGCCACCCCACCAGCACCATGCCCGCCACCAACTCCATCGCCCATGCCACCGTC
CCCACCGAAGCAAGACATGTGTCCCATTGACGCGCTCAAGCTAGGCGCGTGTGTGGACTTGTTAGGAGGGCTAGTCCACATTGGAATCGGACAAAGCGCC
AAGTCGACTTGCTGCCCTCTTGTACAAGGGCTAGCTGATTTGGATGCTGCCTTGTGCCTTTGCACCACCATCAAGCTCAAGCTTCTCAACATCAACCTTA
TCCTTCCCATTGCTCTCGAAGTCCTCCTTGACTGTGGGAAGAACCCTCCTGCTGGTTTCAAGTGTCCTTCGTAA
AA sequence
>Lus10010479 pacid=23154137 polypeptide=Lus10010479 locus=Lus10010479.g ID=Lus10010479.BGIv1.0 annot-version=v1.0
MAKQYYSLASFLLFLVLNLGALIVPSLACPSCTLPPPPCPPTKPPTVKPPHVPKPPHVKPPHVPKPPVKPPHVKPPVKPTPPTVKPTPPVKPTPPTVKPT
PPVKPTPPTVKPTPPVKPTPPTVKPTPPTVKPTPPTVKPTPPTVKPTPPATPPAPCPPPTPSPMPPSPPKQDMCPIDALKLGACVDLLGGLVHIGIGQSA
KSTCCPLVQGLADLDAALCLCTTIKLKLLNINLILPIALEVLLDCGKNPPAGFKCPS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G22142 Bifunctional inhibitor/lipid-t... Lus10010479 0 1
Lus10003802 1.4 0.9752
AT2G44990 MAX3, CCD7, ATC... carotenoid cleavage dioxygenas... Lus10021241 4.7 0.9588
AT5G59380 MBD6, ATMBD6 methyl-CPG-binding domain 6 (.... Lus10005460 5.7 0.9451
AT1G43800 Plant stearoyl-acyl-carrier-pr... Lus10018926 6.7 0.9587
AT1G03910 unknown protein Lus10035558 8.7 0.9347
AT3G53250 SAUR-like auxin-responsive pro... Lus10009219 9.5 0.9442
AT2G41945 unknown protein Lus10021080 9.8 0.9298
AT3G17910 EMB3121, SURF1 SURFEIT 1, EMBRYO DEFECTIVE 31... Lus10031907 11.7 0.9355
AT1G28120 unknown protein Lus10026630 11.8 0.9463
AT5G39890 Protein of unknown function (D... Lus10003861 12.2 0.9569

Lus10010479 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.