Lus10010480 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G22142 55 / 5e-09 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
AT2G10940 53 / 1e-08 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
AT1G62500 53 / 1e-08 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
AT4G15160 43 / 3e-05 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
AT3G22120 43 / 6e-05 CWLP cell wall-plasma membrane linker protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10010479 113 / 3e-31 AT3G22142 168 / 3e-47 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Lus10003802 103 / 5e-27 ND 127 / 5e-33
Lus10003801 103 / 7e-27 AT3G22142 168 / 7e-47 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Lus10010482 96 / 3e-26 AT3G22142 162 / 5e-48 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Lus10032262 62 / 1e-11 AT1G62500 162 / 3e-48 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Lus10032257 47 / 1e-06 AT4G12490 157 / 1e-49 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Lus10001493 45 / 2e-06 AT1G62510 111 / 2e-32 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Lus10006191 44 / 5e-06 AT1G62510 103 / 5e-29 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Lus10024621 44 / 1e-05 AT4G12490 147 / 2e-45 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G008300 76 / 3e-17 AT3G22142 113 / 2e-28 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Potri.006G008500 75 / 5e-17 AT3G22120 80 / 6e-18 cell wall-plasma membrane linker protein (.1)
Potri.016G015500 73 / 2e-15 AT3G22142 161 / 1e-42 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Potri.006G065500 45 / 4e-06 AT2G10940 147 / 8e-44 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
Potri.001G158400 40 / 0.0002 AT1G62510 132 / 1e-40 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Potri.018G025900 39 / 0.0003 AT2G45180 127 / 8e-39 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Potri.018G126000 40 / 0.0006 AT2G10940 109 / 2e-27 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
PFAM info
Representative CDS sequence
>Lus10010480 pacid=23154108 polypeptide=Lus10010480 locus=Lus10010480.g ID=Lus10010480.BGIv1.0 annot-version=v1.0
ATGGGAAGGATAAGGTTGATGTTGAGAAGCTTGAGCTTGATGGTGGTGCAAAGGCACAAGGCAGCATCCAAATCAGCTAGCCCTTGTACAAGAGGGCAGC
AAGTCGACTTGGCGCTTTGTCCGATTCCAATGTGGACTAGCCCTCCTAACAAGTCCACACACGCGCCTAGCTTGAGCGCGTCAATGGGACACATGTCTTG
CTTCGGTGGGGACGGTGGCATGGGCGATGGAGTTGGTGGCGGGCATGGTGCTGGTGGGGTGGCTGGTGGCGTTGGCTTGACTGTGGGTGGTGTTGGCTTG
ACAGTTGGTGGGGTAGGCTTGACAGTCGGTGGGGTTGGCTTGACAGTTGGGGGTGTTGGCTTCACGGGTGGTGTTGGCTTGACAGTTGGTGGTGTTGGCT
TCACGGGTGGCGTTGGCTTGACAGTAGGTGGTGTTGGCTTGACAGGTGGTGTTGGCTTGACAGTGGGTGGTGTTGGCTTGACAGGCGGCTTGACATGTGG
TGGCTTAACCGGTGGCTTGGGAACATGA
AA sequence
>Lus10010480 pacid=23154108 polypeptide=Lus10010480 locus=Lus10010480.g ID=Lus10010480.BGIv1.0 annot-version=v1.0
MGRIRLMLRSLSLMVVQRHKAASKSASPCTRGQQVDLALCPIPMWTSPPNKSTHAPSLSASMGHMSCFGGDGGMGDGVGGGHGAGGVAGGVGLTVGGVGL
TVGGVGLTVGGVGLTVGGVGFTGGVGLTVGGVGFTGGVGLTVGGVGLTGGVGLTVGGVGLTGGLTCGGLTGGLGT

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10010480 0 1
AT2G20515 unknown protein Lus10022928 6.8 0.9340
AT1G37140 MCT1 MEI2 C-terminal RRM only like ... Lus10025640 8.9 0.9441
AT3G06580 GAL1, GALK GALACTOSE KINASE 1, Mevalonate... Lus10023094 14.8 0.8855
AT4G40042 Microsomal signal peptidase 12... Lus10006422 16.8 0.8661
AT3G22142 Bifunctional inhibitor/lipid-t... Lus10003801 17.3 0.8632
AT3G26120 TEL1 terminal EAR1-like 1 (.1) Lus10036953 21.2 0.9306
Lus10038209 23.7 0.9281
AT5G23570 SGS3, ATSGS3 SUPPRESSOR OF GENE SILENCING 3... Lus10026697 24.6 0.9255
AT1G29140 Pollen Ole e 1 allergen and ex... Lus10013681 28.7 0.9254
AT2G27250 AtCLV3, CLV3 CLAVATA3 (.1.2.3) Lus10013340 31.3 0.9241

Lus10010480 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.