Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G22142 93 / 1e-23 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G15160 84 / 1e-21 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT3G22120 80 / 2e-19 CWLP cell wall-plasma membrane linker protein (.1) AT1G62500 79 / 5e-19 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G10940 72 / 2e-16 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT4G12470 58 / 6e-12 AZI1 azelaic acid induced 1 (.1) AT4G12480 54 / 1e-10 PEARLI 1 1, PEARLI 1, pEARLI1 EARLY ARABIDOPSIS ALUMINUM INDUCED 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12500 54 / 3e-10 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12490 53 / 8e-10 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G45180 50 / 5e-09 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10010479 [exp] 107 / 2e-30 AT3G22142 168 / 3e-47 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10003801 [exp] 108 / 4e-30 AT3G22142 168 / 7e-47 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10032262 [exp] 79 / 5e-19 AT1G62500 162 / 3e-48 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10010480 [exp] 76 / 2e-18 ND 127 / 3e-34 Lus10003802 [exp] 76 / 4e-18 ND 127 / 5e-33 Lus10028930 [exp] 75 / 4e-18 AT1G62500 141 / 4e-41 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10004349 [exp] 67 / 9e-15 AT1G62500 134 / 5e-38 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10027704 [exp] 62 / 3e-13 AT2G10940 135 / 2e-39 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10001493 [exp] 57 / 1e-11 AT1G62510 111 / 2e-32 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G008300 [exp] 99 / 5e-27 AT3G22142 113 / 2e-28 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.006G008500 [exp] 96 / 1e-26 AT3G22120 80 / 6e-18 cell wall-plasma membrane linker protein (.1) Potri.016G015500 [exp] 93 / 9e-24 AT3G22142 161 / 1e-42 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.006G065500 [exp] 73 / 2e-17 AT2G10940 147 / 8e-44 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.003G111300 [exp] 72 / 7e-17 AT1G62500 125 / 2e-34 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.018G126000 [exp] 72 / 1e-16 AT2G10940 109 / 2e-27 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.018G025900 [exp] 55 / 3e-11 AT2G45180 127 / 8e-39 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.008G135860 [exp] 54 / 4e-10 AT1G62500 75 / 7e-16 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G121900 [exp] 51 / 1e-09 AT1G62510 99 / 5e-27 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G158400 [exp] 49 / 8e-09 AT1G62510 132 / 1e-40 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [flax] [poplar] Prolamin PF00234 [flax] [poplar] Tryp_alpha_amyl Protease inhibitor/seed storage/LTP family
Representative CDS sequence Show only first row Show all	>Lus10010482 pacid=23154106 polypeptide=Lus10010482 locus=Lus10010482.g ID=Lus10010482.BGIv1.0 annot-version=v1.0 ATGCAAAACATGTGTCCCATCGACGCCTTGAAGCTAGGCTCGTGTGTGGATGTGCTGGGCGGACTAGTCCACATTGGAATAGGACAGAGTGCCAAGTCGG CTTGCTGCCCTCTTGTGCAAGGACTAGCTGATCTAGATGCTGCCTTGTGCCTTTGCACCACCATCAAGCTCAAGCTTTTGAATGTCAACCTCATCCTCCC CATTGCTCTTGAGGTTCTCGTCGACTGTGGGAAGAATCCTCCTATGGGTTTCAAGTGTCCCTCCTAA
AA sequence Show only first row Show all	>Lus10010482 pacid=23154106 polypeptide=Lus10010482 locus=Lus10010482.g ID=Lus10010482.BGIv1.0 annot-version=v1.0 MQNMCPIDALKLGSCVDVLGGLVHIGIGQSAKSACCPLVQGLADLDAALCLCTTIKLKLLNVNLILPIALEVLVDCGKNPPMGFKCPS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G22142			Bifunctional inhibitor/lipid-t...		Lus10010482 [exp]	0	1
AT1G79690		ATNUDT3	nudix hydrolase homolog 3 (.1)		Lus10024090 [exp]	1.0	0.9937
					Lus10010481 [exp]	1.4	0.9883
AT3G19760		EIF4A-III	eukaryotic initiation factor 4...		Lus10040975 [exp]	1.7	0.9850
AT1G15260			unknown protein		Lus10037547 [exp]	2.0	0.9763
AT2G26710		CYP72B1, CYP734...	PHYB ACTIVATION TAGGED SUPPRES...		Lus10036818 [exp]	3.5	0.9577
					Lus10041394 [exp]	3.7	0.9560
AT1G23070			Protein of unknown function (D...		Lus10036614 [exp]	3.9	0.9638
AT4G28320		MAN5, AtMAN5	endo-beta-mannase 5, Glycosyl ...		Lus10039719 [exp]	6.0	0.9314
AT4G12310		CYP706A5	"cytochrome P450, family 706, ...		Lus10032210 [exp]	8.0	0.9540
AT1G17840		AtABCG11, WBC11...	DESPERADO, CUTICULAR DEFECT AN...		Lus10000638 [exp]	8.9	0.9107

Compare expression of checked genes

Lus10010482 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.