Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G47550 73 / 9e-18 Cystatin/monellin superfamily protein (.1) AT4G16500 52 / 1e-09 Cystatin/monellin superfamily protein (.1) AT5G05110 48 / 1e-07 Cystatin/monellin family protein (.1) AT3G12490 44 / 3e-06 ATCYS6, ATCYSB ARABIDOPSIS THALIANA PHYTOCYSTATIN 6, cystatin B (.1.2) AT2G40880 41 / 2e-05 ATCYSA, FL3-27 cystatin A (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10017567 [exp] 222 / 2e-76 AT5G47550 69 / 7e-16 Cystatin/monellin superfamily protein (.1) Lus10034773 [exp] 96 / 6e-27 AT5G47550 65 / 1e-14 Cystatin/monellin superfamily protein (.1) Lus10033311 [exp] 88 / 3e-23 ND 59 / 6e-12 Lus10039104 [exp] 73 / 8e-18 AT5G47550 74 / 4e-18 Cystatin/monellin superfamily protein (.1) Lus10027320 [exp] 55 / 1e-10 AT5G47550 59 / 4e-12 Cystatin/monellin superfamily protein (.1) Lus10026779 [exp] 42 / 9e-06 AT3G12490 129 / 2e-39 ARABIDOPSIS THALIANA PHYTOCYSTATIN 6, cystatin B (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G014500 [exp] 81 / 7e-21 AT5G47550 100 / 9e-29 Cystatin/monellin superfamily protein (.1) Potri.006G014700 [exp] 60 / 1e-12 AT5G47550 62 / 3e-13 Cystatin/monellin superfamily protein (.1) Potri.006G014600 [exp] 54 / 3e-10 AT5G47550 56 / 6e-11 Cystatin/monellin superfamily protein (.1) Potri.001G225800 [exp] 40 / 2e-05 AT3G12490 142 / 4e-44 ARABIDOPSIS THALIANA PHYTOCYSTATIN 6, cystatin B (.1.2) Potri.014G149300 [exp] 40 / 4e-05 AT2G31980 90 / 1e-23 PHYTOCYSTATIN 2 (.1) Potri.006G033201 [exp] 40 / 9e-05 AT3G12490 251 / 8e-86 ARABIDOPSIS THALIANA PHYTOCYSTATIN 6, cystatin B (.1.2) Potri.009G022300 [exp] 39 / 9e-05 AT3G12490 134 / 4e-41 ARABIDOPSIS THALIANA PHYTOCYSTATIN 6, cystatin B (.1.2) Potri.016G030900 [exp] 40 / 0.0001 AT3G12490 244 / 5e-82 ARABIDOPSIS THALIANA PHYTOCYSTATIN 6, cystatin B (.1.2) Potri.003G192200 [exp] 38 / 0.0008 AT3G12490 303 / 6e-105 ARABIDOPSIS THALIANA PHYTOCYSTATIN 6, cystatin B (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0121 [flax] [poplar] Cystatin PF00031 [flax] [poplar] Cystatin Cystatin domain
Representative CDS sequence Show only first row Show all	>Lus10010495 pacid=23154113 polypeptide=Lus10010495 locus=Lus10010495.g ID=Lus10010495.BGIv1.0 annot-version=v1.0 ATGAAGCTGCAGATCACCGTCCTCACCCTCCTCTTCGCCGTCGGCACGGTAGCAGCCTTGCTCGGTGGGTGGACCGAGATCAAGGACCGCACCGATCCGG ATGTCATAGAGGCGGCTAACTTCGCCGTGGATCAGCACAACGCCGAATCCCACACGAAGCTGAAGCTCAAGACTGTGGACAAAGCCGAGTACCAGGTCGT CAATGGGAAGAACTACAGGCTGAGCCTGACCGTCACCGACTCCGTCGGCGAAAAGAAGAACGCGATTTCGCAGTACGAGGCGATTGTCTACGTGCCAGCT GGCATGGGAGGGGTTAAGAAGACGCTGAAGTCGTTCAATCCGAAGAAGAAGCATTAA
AA sequence Show only first row Show all	>Lus10010495 pacid=23154113 polypeptide=Lus10010495 locus=Lus10010495.g ID=Lus10010495.BGIv1.0 annot-version=v1.0 MKLQITVLTLLFAVGTVAALLGGWTEIKDRTDPDVIEAANFAVDQHNAESHTKLKLKTVDKAEYQVVNGKNYRLSLTVTDSVGEKKNAISQYEAIVYVPA GMGGVKKTLKSFNPKKKH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G47550			Cystatin/monellin superfamily ...		Lus10010495 [exp]	0	1
AT5G51700		ATRAR1, RPR2, P...	Required for Mla12 resistance ...		Lus10031107 [exp]	2.0	0.9187
AT1G34780		ATAPRL4	APR-like 4 (.1.2)		Lus10036486 [exp]	4.1	0.9344
AT4G14465	AT-hook	AHL20	AT-hook motif nuclear-localize...		Lus10002711 [exp]	5.8	0.8880
AT1G20575		DPMS1	dolichol phosphate mannose syn...		Lus10013228 [exp]	6.3	0.8872
AT3G20660		4-Oct, ATOCT4	organic cation/carnitine trans...		Lus10014801 [exp]	10.4	0.9056
AT1G74790			catalytics (.1)		Lus10036662 [exp]	10.4	0.9029
AT1G11380			PLAC8 family protein (.1)		Lus10002586 [exp]	14.9	0.9152
AT1G27450		APRT, ATAPT1, A...	ARABIDOPSIS THALIANA ADENINE P...		Lus10007757 [exp]	21.0	0.9022
AT1G24560			unknown protein		Lus10013022 [exp]	21.0	0.8959
AT1G24020		MLP423	MLP-like protein 423 (.1.2)		Lus10010702 [exp]	21.5	0.8247

Compare expression of checked genes

Lus10010495 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.