Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G62650 70 / 1e-15 Tic22-like family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039294 [exp] 118 / 4e-33 AT5G62650 605 / 0.0 Tic22-like family protein (.1) Lus10027537 [exp] 114 / 1e-31 AT5G62650 604 / 0.0 Tic22-like family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G072100 [exp] 83 / 1e-20 AT5G62650 643 / 0.0 Tic22-like family protein (.1) Potri.017G148900 [exp] 82 / 4e-20 AT5G62650 618 / 0.0 Tic22-like family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10010502 pacid=23156692 polypeptide=Lus10010502 locus=Lus10010502.g ID=Lus10010502.BGIv1.0 annot-version=v1.0 ATGGCAGGGATATCCACTGGAGAGACAGGTAAAGTGAGTAAAGCTAGTTTGAAGAAGACGATGGAGAATCTAAGAAAAGAGTTGGAGGAGGCGGACCAAG TTAAAACCTCTAGTAGTGATAATGGTGATGGTGATTTCAAAATCACAGATGGAGATCCACTGTTTGTGGCGAACGTGGGTGATTACTCCGGGGGATTCGT CGAGGAATGA
AA sequence Show only first row Show all	>Lus10010502 pacid=23156692 polypeptide=Lus10010502 locus=Lus10010502.g ID=Lus10010502.BGIv1.0 annot-version=v1.0 MAGISTGETGKVSKASLKKTMENLRKELEEADQVKTSSSDNGDGDFKITDGDPLFVANVGDYSGGFVEE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G62650			Tic22-like family protein (.1)		Lus10010502 [exp]	0	1
					Lus10009807 [exp]	2.2	0.7348
AT3G26230		CYP71B24	"cytochrome P450, family 71, s...		Lus10034397 [exp]	4.2	0.7004
					Lus10039655 [exp]	6.9	0.6670
AT4G35380			SEC7-like guanine nucleotide e...		Lus10022975 [exp]	10.5	0.6904
AT3G26740		CCL	CCR-like (.1)		Lus10041522 [exp]	19.5	0.7125
AT5G07630			lipid transporters (.1)		Lus10027222 [exp]	21.2	0.5951
AT4G10270			Wound-responsive family protei...		Lus10031616 [exp]	21.4	0.6977
AT1G11290		CRR22	CHLORORESPIRATORY REDUCTION22,...		Lus10028837 [exp]	21.9	0.6499
AT4G34660			SH3 domain-containing protein ...		Lus10028785 [exp]	23.3	0.6105
AT1G18660			zinc finger (C3HC4-type RING f...		Lus10019075 [exp]	31.7	0.6088

Compare expression of checked genes

Lus10010502 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.