Lus10010526 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10034070 0 / 1 AT5G19330 1092 / 0.0 ARM repeat protein interacting with ABF2 (.1.2)
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10010526 pacid=23156696 polypeptide=Lus10010526 locus=Lus10010526.g ID=Lus10010526.BGIv1.0 annot-version=v1.0
ATGGGTTGCTTCTCATCGCTCCGGCCACGAGAAAGAACCGTGGTTATTGGATCATGGGGATTTTGCCGGGTGTCCATCGGCGGCGACATCCCAGACAGGG
ATATGGTTCACAAGTTGGGTCAGAGAGCAGGGTACAAAGGCTTGTTCAAAGATACAGATCAGCGGGTTCCGGTTGGGAACAGCAAGTATGAAATGGAGTG
TAGGAGTGCAGGAATGTTGGGGCACGTGATGTCGAGGAGTCAGAGAGCATCGGGTTTCACTTACGTAGTGCTGAACGCCAAGTTCTACCGTGGATGTATT
GTCCCGGTTATTAAAGCAGCTCTACGCCGACAGCTGGGATCTGTAATGTCCTCTGCCTCCTCAAAGCTTCTTCAGTGA
AA sequence
>Lus10010526 pacid=23156696 polypeptide=Lus10010526 locus=Lus10010526.g ID=Lus10010526.BGIv1.0 annot-version=v1.0
MGCFSSLRPRERTVVIGSWGFCRVSIGGDIPDRDMVHKLGQRAGYKGLFKDTDQRVPVGNSKYEMECRSAGMLGHVMSRSQRASGFTYVVLNAKFYRGCI
VPVIKAALRRQLGSVMSSASSKLLQ

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10010526 0 1
AT4G23160 CRK8 cysteine-rich RLK (RECEPTOR-li... Lus10015093 1.0 0.9750
AT3G12160 AtRABA4d ARABIDOPSIS THALIANA RAB GTPAS... Lus10012032 4.2 0.9664
AT1G61330 FBD, F-box and Leucine Rich Re... Lus10018433 6.2 0.8800
AT1G51990 O-methyltransferase family pro... Lus10005268 6.5 0.8269
Lus10005843 8.0 0.8725
Lus10022511 8.9 0.8725
AT2G36690 2-oxoglutarate (2OG) and Fe(II... Lus10024231 9.8 0.8725
AT1G15550 ATGA3OX1, GA4 GA REQUIRING 4, ARABIDOPSIS TH... Lus10013135 10.6 0.8725
AT5G17490 GRAS AtRGL3, RGL3 RGA-like protein 3 (.1) Lus10002424 11.3 0.8725
AT4G21390 B120 S-locus lectin protein kinase ... Lus10032836 12.0 0.8725

Lus10010526 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.