Lus10010539 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G31670 77 / 5e-16 Copper amine oxidase family protein (.1)
AT1G31710 75 / 2e-15 Copper amine oxidase family protein (.1)
AT1G31690 73 / 9e-15 Copper amine oxidase family protein (.1)
AT4G14940 67 / 1e-12 ATAO1 amine oxidase 1 (.1)
AT4G12290 64 / 1e-11 Copper amine oxidase family protein (.1)
AT4G12280 59 / 2e-10 copper amine oxidase family protein (.1)
AT3G43670 57 / 3e-09 Copper amine oxidase family protein (.1)
AT1G62810 54 / 3e-08 Copper amine oxidase family protein (.1)
AT2G42490 44 / 5e-05 Copper amine oxidase family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10026757 89 / 3e-20 AT1G31690 727 / 0.0 Copper amine oxidase family protein (.1)
Lus10004912 76 / 2e-15 AT1G31710 738 / 0.0 Copper amine oxidase family protein (.1)
Lus10021922 68 / 5e-13 AT4G14940 839 / 0.0 amine oxidase 1 (.1)
Lus10024571 61 / 2e-10 AT4G12290 993 / 0.0 Copper amine oxidase family protein (.1)
Lus10032209 60 / 3e-10 AT4G12290 996 / 0.0 Copper amine oxidase family protein (.1)
Lus10024568 59 / 8e-10 AT1G62810 914 / 0.0 Copper amine oxidase family protein (.1)
Lus10041208 58 / 1e-09 AT1G31690 369 / 9e-122 Copper amine oxidase family protein (.1)
Lus10010540 80 / 0.0001 AT1G31710 761 / 0.0 Copper amine oxidase family protein (.1)
Lus10013356 0 / 1 AT1G31690 499 / 5e-173 Copper amine oxidase family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G089050 88 / 8e-20 AT1G31710 780 / 0.0 Copper amine oxidase family protein (.1)
Potri.010G088800 83 / 4e-18 AT1G31710 782 / 0.0 Copper amine oxidase family protein (.1)
Potri.008G151900 80 / 5e-17 AT1G31690 793 / 0.0 Copper amine oxidase family protein (.1)
Potri.010G088900 69 / 2e-13 AT4G14940 904 / 0.0 amine oxidase 1 (.1)
Potri.001G118200 58 / 1e-09 AT1G62810 961 / 0.0 Copper amine oxidase family protein (.1)
Potri.015G082900 46 / 1e-05 AT2G42490 1256 / 0.0 Copper amine oxidase family protein (.1)
Potri.012G084400 45 / 3e-05 AT2G42490 1250 / 0.0 Copper amine oxidase family protein (.1)
Potri.010G045600 41 / 0.0006 AT2G42490 1202 / 0.0 Copper amine oxidase family protein (.1)
Potri.001G118300 0 / 1 AT4G12290 1060 / 0.0 Copper amine oxidase family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0103 Gal_mutarotase PF01179 Cu_amine_oxid Copper amine oxidase, enzyme domain
Representative CDS sequence
>Lus10010539 pacid=23156688 polypeptide=Lus10010539 locus=Lus10010539.g ID=Lus10010539.BGIv1.0 annot-version=v1.0
ATGGTAGTGGACCTTGACGAGATGAAGATTGTCGATTTTAGTGTCAGGGAATTTGTGCCGTTGCCCAAAGTCGACGACATCACGTCTGAGTATAGGATGG
ATGAACTGGGAACTGCACGTGGCATTCGACGCCCGTCCGGGTCTAGTGATATCCCGGGCCCGAATCTACGACCCGGAAAAGCATGCTTTCCGCAGCGTCT
TATACAGAGGACACCTCCGGGGACTACTATTTCCGAACATTCTTCGACTGCGGTGAATTCGGGTTTGGTCTCTCCGCCGTGTCCCTCGTCTCTCGCGGCG
ATTGCCCTTCCAACGCCGTCTTCATGGACGGTTATTACGCCAGTTCCGACGGAACTCCCGTCAAAGTCCCCAATGTGTTCTGCATATTCGAGAGGCACGC
TGGCGAAATCATGTGGCGCCACACTGAAGCCCACATCCCCCGTCAACTGGTATACGTGGCGCCACGTGATCAATGAAGTGAGAGCAGAGGTTAGCCTGGT
GATAAGGATGGTAGCCACAGTTGGAAACTGTGATCACATCGTTGATTGGGAGTTCAAGCCCAGTGGGTCCATTAAGGTCCAAGTGGGCCTCAGTGGAATT
GTAGAAGCAAACCAGTCAATTTCAGCACTTCAGCCCATATCACAGAAGAAGCCCACAAAACTCTACTCGCGTCCAATACAATTGGACTATACCACGACCA
TTTCTTGA
AA sequence
>Lus10010539 pacid=23156688 polypeptide=Lus10010539 locus=Lus10010539.g ID=Lus10010539.BGIv1.0 annot-version=v1.0
MVVDLDEMKIVDFSVREFVPLPKVDDITSEYRMDELGTARGIRRPSGSSDIPGPNLRPGKACFPQRLIQRTPPGTTISEHSSTAVNSGLVSPPCPSSLAA
IALPTPSSWTVITPVPTELPSKSPMCSAYSRGTLAKSCGATLKPTSPVNWYTWRHVINEVRAEVSLVIRMVATVGNCDHIVDWEFKPSGSIKVQVGLSGI
VEANQSISALQPISQKKPTKLYSRPIQLDYTTTIS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G31670 Copper amine oxidase family pr... Lus10010539 0 1
Lus10001872 1.0 0.9993
AT3G05950 RmlC-like cupins superfamily p... Lus10038456 1.4 0.9984
AT2G16730 BGAL13 beta-galactosidase 13, glycosy... Lus10019783 3.0 0.9892
Lus10004634 4.0 0.9850
AT3G15670 Late embryogenesis abundant pr... Lus10004395 4.5 0.9674
AT5G07050 nodulin MtN21 /EamA-like trans... Lus10041634 6.7 0.9413
Lus10006761 6.9 0.9339
AT2G45650 MADS AGL6 AGAMOUS-like 6 (.1) Lus10015017 7.5 0.9498
AT3G19550 unknown protein Lus10002115 8.5 0.9567
Lus10038743 14.5 0.9363

Lus10010539 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.