Plant FIBer expression Database

Lus10010543 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G43150 45 / 2e-07 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10004910
[exp]
137 / 3e-44 AT5G43150 45 / 1e-07 unknown protein
Lus10015934
[exp]
61 / 2e-12 AT2G27410 48 / 3e-06 Domain of unknown function (DUF313) (.1)
Lus10041628
[exp]
39 / 2e-05 AT5G43150 52 / 3e-10 unknown protein
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G088200
[exp]
97 / 1e-28 AT5G43150 40 / 8e-06 unknown protein
Potri.008G152200
[exp]
97 / 3e-28 AT5G43150 41 / 9e-06 unknown protein
Potri.013G037800
[exp]
88 / 5e-25 AT5G43150 39 / 2e-05 unknown protein
Potri.005G211000
[exp]
86 / 3e-24 ND /
Potri.003G187500
[exp]
44 / 3e-07 AT5G43150 51 / 8e-10 unknown protein
Potri.001G037400
[exp]
41 / 4e-06 AT5G43150 56 / 1e-11 unknown protein
Potri.002G119700
[exp]
37 / 9e-05 AT5G43150 58 / 1e-12 unknown protein
Potri.006G070200
[exp]
35 / 0.0008 ND /
PFAM info
Representative CDS sequence
>Lus10010543 pacid=23156680 polypeptide=Lus10010543 locus=Lus10010543.g ID=Lus10010543.BGIv1.0 annot-version=v1.0
ATGGGGTGGCTTCAATCCCTCTTCTCCCCATTGAAGAAGCTCTGGTTCCGCCTCCACACCACCACTCCTAACAAGAGAGGAAGAGGGATATACATTCTGT
ATGAGGATGTGAAGTCATGTCCATACGAGGATGTTCATGTTCTATGGTCTATACTGGTAGAGTCTCATGATTCCCCTTCTTCCCCTAACCTGCTACAACT
GCAGCAGCAGCTGCCGAAAGAATGA
AA sequence
>Lus10010543 pacid=23156680 polypeptide=Lus10010543 locus=Lus10010543.g ID=Lus10010543.BGIv1.0 annot-version=v1.0
MGWLQSLFSPLKKLWFRLHTTTPNKRGRGIYILYEDVKSCPYEDVHVLWSILVESHDSPSSPNLLQLQQQLPKE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G43150 unknown protein Lus10010543
[exp]
0 1
AT5G43150 unknown protein Lus10004910
[exp]
1.0 0.9741
AT5G47810 PFK2 phosphofructokinase 2 (.1) Lus10008812
[exp]
1.4 0.9443
AT5G49900 Beta-glucosidase, GBA2 type fa... Lus10003517
[exp]
2.0 0.9145
AT5G55490 GEX1, ATGEX1 gamete expressed protein 1 (.1... Lus10039900
[exp]
4.9 0.8515
AT5G47635 Pollen Ole e 1 allergen and ex... Lus10039078
[exp]
4.9 0.9188
AT5G53550 ATYSL3, YSL3 YELLOW STRIPE like 3 (.1.2) Lus10008836
[exp]
5.5 0.8760
AT2G30860 GLUTTR, ATGSTF7... glutathione S-transferase PHI ... Lus10001419
[exp]
6.3 0.8925
AT5G65380 MATE efflux family protein (.1... Lus10015903
[exp]
12.2 0.8320
AT1G27200 Domain of unknown function (DU... Lus10030815
[exp]
12.4 0.8648
AT3G07490 AtCML3, AGD11 calmodulin-like 3, ARF-GAP dom... Lus10009564
[exp]
13.0 0.8645

Lus10010543 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.