Lus10010548 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10004903 87 / 2e-21 ND /
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10010548 pacid=23156644 polypeptide=Lus10010548 locus=Lus10010548.g ID=Lus10010548.BGIv1.0 annot-version=v1.0
ATGGCTTCTGGGTTTTTCCTGGATTCACATTTAGCGTTTGCTCTAGCCTTGGCCATCTTCTTCAGCAATCCTAACTTGTCCTCTTCTTCTTCCGCACCAC
CGCCGCTTTCAGACAGTGATTATCATGGGCCAACTCAACTTGATTGGAAAGTTGAATTGTTTTGTTATGCATCAGTGCCAGTGGTGTTGGTTGCCATTGT
CATGATTCACGGGAAGCAGCACTATTGTCATGATTCAGAGACCGTTAACACGCTGTTGAGACACCAACAGAGTATCATCTATGGCTCCACAACTATGAAA
CGTGGAAAAAGTACACCACTGGAAATATTAATGCAGAAAGTCTTGCTTGAGAATCTTAAATACGTGCCTGAACGTACTCCCAAACAGGCTAATTTGGTAA
CTGAACTTTTGTTGGGTGGATGTGGCCAAGTCTTTCCATGGGTTTCACCAACTTAA
AA sequence
>Lus10010548 pacid=23156644 polypeptide=Lus10010548 locus=Lus10010548.g ID=Lus10010548.BGIv1.0 annot-version=v1.0
MASGFFLDSHLAFALALAIFFSNPNLSSSSSAPPPLSDSDYHGPTQLDWKVELFCYASVPVVLVAIVMIHGKQHYCHDSETVNTLLRHQQSIIYGSTTMK
RGKSTPLEILMQKVLLENLKYVPERTPKQANLVTELLLGGCGQVFPWVSPT

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10010548 0 1
AT4G02420 Concanavalin A-like lectin pro... Lus10016226 14.3 0.7398
AT5G40270 HD domain-containing metal-dep... Lus10013004 16.9 0.7614
AT2G03510 SPFH/Band 7/PHB domain-contain... Lus10036912 17.1 0.7056
AT4G25650 TIC55-IV, PTC52... TRANSLOCON AT THE INNER ENVELO... Lus10025413 18.4 0.7903
AT3G04030 GARP Homeodomain-like superfamily p... Lus10002629 23.8 0.7917
AT4G17540 unknown protein Lus10040155 29.1 0.7842
AT3G57810 Cysteine proteinases superfami... Lus10037002 29.2 0.7834
AT4G10790 UBX domain-containing protein ... Lus10027684 30.0 0.7911
AT1G35470 SPla/RYanodine receptor (SPRY)... Lus10020191 34.6 0.7868
AT1G07400 HSP20-like chaperones superfam... Lus10022604 35.0 0.7864

Lus10010548 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.